SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000006979 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000006979
Domain Number 1 Region: 19-466
Classification Level Classification E-value
Superfamily Integrin alpha N-terminal domain 3.01e-95
Family Integrin alpha N-terminal domain 0.000000000381
Further Details:      
 
Domain Number 2 Region: 765-979
Classification Level Classification E-value
Superfamily Integrin domains 1.78e-48
Family Integrin domains 0.0000561
Further Details:      
 
Domain Number 3 Region: 468-624
Classification Level Classification E-value
Superfamily Integrin domains 4.81e-44
Family Integrin domains 0.0000112
Further Details:      
 
Domain Number 4 Region: 625-758
Classification Level Classification E-value
Superfamily Integrin domains 5.75e-31
Family Integrin domains 0.0000217
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000006979   Gene: ENSCPOG00000007748   Transcript: ENSCPOT00000007822
Sequence length 1026
Comment pep:known_by_projection scaffold:cavPor3:scaffold_9:45416834:45438614:1 gene:ENSCPOG00000007748 transcript:ENSCPOT00000007822 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PHTPYKGSLCPPPEGVGGFNLDSEAPAVLLGPPGSFFGYSVEFYRPGTDGVSVLVGAPKA
NTSQPGVLQGGAVYFCPWGTSPGQCMPIEFDSKGSRNLESSLSSAEGKEPVEYKSLQWFG
ATIRAHGSSILACAPLYSWRTEKEPLVDPVGTCYLSTGNFTRILEYAPCRSDFSSAAGQG
YCQGGFSAEITKTGRVVLGGPGSYFWQGQILSATQEQIEESYYPEYLINLVQGQLQTRQA
SSIYDDSYMGYSVAVGEFSGDDTEDFVAGVPKGNLTYGYVTILNGSDIRSLYNFSGEQMA
SYFGYAVAATDINGDGLDDLLVGAPLLMERTADGRPQEVGRVYIYMQHPAGIDPTPTLSL
TGYDEFGRFGSSLTPLGDLDQDGYNDVAVGAPFGGETQQGVVFVFPGGPGGLGSKPSQVL
QPLWAAGHTPDFFGSALRGGQDLDSNGYPDLIVGSFGVDKAVVYRGRPIVSASASLTIFP
AMFNPEERSCSLEGNPVACINLSFCLNASGKHVPNSIGFTVELQLDWQKQKGGIRRALFL
ASKQATLTETLLIQNGAQEECREMKIYLRNESEFRDKLSPIHIALNFSLDPKAPTDSHGL
RPVLHYQSKNRIEDKAQILLDCGEDNICVPDLQLEVFGDQNRVYLGNKDTLNLTFHAQNV
GEGGAYEAELRVTAPLEAEYIGFVRNPGNFSSLSCDYFTVNQSLLVCDLGNPMKAGASLW
GGLRFTVRHLQDTQENIQFDFQILSKNLNNSQSDVVSYRLSVEAQAEVSLNGVSKPEAVL
FPASDWHPPNQPQTEGDVGPAVHHVYELINHGPSTISQGVLDISCPQTWEGHQLLYVTRV
TGLPNCTTNYTPNLQGLELDPEEAPHHLQRRDAPGRSPASSGPQVLKCPEAECFRLHCDL
GPVPRQQSLSLQLHFRVWAKTFLQKEQLPFSLQCEAEYKALKMPYRILPQQLPQKKLQVA
TAVQWTKAEGSNGVPLWIIILAILFGLLLLGLLIYVLYKLGFFKRSLPYGTAMEKAQLKP
PATSDA
Download sequence
Identical sequences ENSCPOP00000006979 10141.ENSCPOP00000006979 ENSCPOP00000006979

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]