SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000007053 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000007053
Domain Number 1 Region: 45-418
Classification Level Classification E-value
Superfamily Integrin alpha N-terminal domain 8.5e-49
Family Integrin alpha N-terminal domain 0.013
Further Details:      
 
Domain Number 2 Region: 545-598
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000251
Family EGF-type module 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000007053   Gene: ENSCPOG00000007832   Transcript: ENSCPOT00000007907
Sequence length 637
Comment pep:known_by_projection scaffold:cavPor3:scaffold_1:31521041:31641643:-1 gene:ENSCPOG00000007832 transcript:ENSCPOT00000007907 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VLRMLPLLLLLWFLPPTEGSQRAEPMFIAVTNSVLPPDYDSNPTQLNYGVAVTDVDHDGD
FEIVVAGYNGPNLVLKYDRAKKRLVNIAVDERSSPYYALRDRQGNAIGVTACDIDGDGRE
EIYFLNTNNAFSGVATYTDKLFKFRNNRWEDILSDEVNMARGVASLFAGRSVACVDRTGS
GRYSIYIANYAYGNVGPDALIEMDPEASDPSRGILALRDVAAEAGVSKYTGGRGVSVGPI
LSNSASDIFCDNENGPNFLFHNQGNGTFVDAAASAGVDDPHQHGRGVALADFNRDGKVDI
VYGNWNGPHRLYLQMSAQGKVRFRDIASPKFAMPSPVRTVIAADFDNDQELEIFFNNIAY
RSSSANRLFRVIRREHGDPLIEELNPGDALEPEGRGTGGVVTDFDGDGMLDLILSHGESM
AQPLSVFRVNQGFSNNWLRVVPRTQFGAFARGAKVVLYTKKSGAHLRIIDGGSGYLCEME
PVAHFGLGRDEASSVEVTWPDGKMVSRSVASRELNSVLQIPYPRDEDKLQDPAPLECGQG
FSQQERGHCVDTDECIQFPFVCPRDKPVCVNTYGSYRCRTNKRCSRGYEPNEDGTACVAQ
VAFLGGYSSAAFRISEPLSQASYLSLGLGLCLQLYAL
Download sequence
Identical sequences ENSCPOP00000007053 ENSCPOP00000007053 10141.ENSCPOP00000007053

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]