SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000007089 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000007089
Domain Number 1 Region: 18-74
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 4.44e-17
Family Ovomucoid domain III-like 0.00047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000007089   Gene: ENSCPOG00000007875   Transcript: ENSCPOT00000007950
Sequence length 74
Comment pep:known_by_projection scaffold:cavPor3:scaffold_6:10245097:10252642:1 gene:ENSCPOG00000007875 transcript:ENSCPOT00000007950 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FINYSVWVLCFFSGVFTQGEQVDCSKFSDPKFFCTRESNPHCGSDGQTYGNKCAFCKAVA
KSNGKISLKHHGKC
Download sequence
Identical sequences ENSCPOP00000007089

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]