SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000007221 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000007221
Domain Number 1 Region: 274-394
Classification Level Classification E-value
Superfamily EF-hand 5.33e-31
Family Osteonectin 0.02
Further Details:      
 
Domain Number 2 Region: 183-255
Classification Level Classification E-value
Superfamily Thyroglobulin type-1 domain 9.81e-21
Family Thyroglobulin type-1 domain 0.0014
Further Details:      
 
Domain Number 3 Region: 48-129
Classification Level Classification E-value
Superfamily Thyroglobulin type-1 domain 2.09e-20
Family Thyroglobulin type-1 domain 0.0011
Further Details:      
 
Domain Number 4 Region: 12-58
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.000000000305
Family Ovomucoid domain III-like 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000007221   Gene: ENSCPOG00000008023   Transcript: ENSCPOT00000008098
Sequence length 418
Comment pep:known_by_projection scaffold:cavPor3:scaffold_58:2898522:2985843:-1 gene:ENSCPOG00000008023 transcript:ENSCPOT00000008098 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FLRVDQDKDRDCSLDCTGSPQRPLCASDGRTFLSRCEFQRAKCKDPRLEIAYRGNCKDVS
RCVAERKYTQEQARKELQQVFIPECNEDGTYSQVQCHSYTGYCWCVTPNGRPVSGTAVAH
KTPRCPGSINEKLPQREGTGKTDDAVAPALETQPQGDEEDIASRYPTLWTEQVKSRQNKT
NKNSASSCDQEHQSALEEAKQPKNDNVVIPECAHGGLYKPVQCHPSTGYCWCVLVDTGRP
IPGTSTRYEQPKCDHTARAHPTKARDLYRSRQLQGCPGAKKHEFLTSVLDALSTDMVHAV
SDPSSASSRLSEPDPSHTLEERVVHWYFRLLDKNGSGDIGKKEIKPFKRFLRKKSKPKKC
VKKFVEYCDANSDHSLSVRELMGCLGVAQEEGTASTRKRHTPRGNAEGPANRQPRKQG
Download sequence
Identical sequences ENSCPOP00000007221 ENSCPOP00000007221 10141.ENSCPOP00000007221

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]