SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000007227 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000007227
Domain Number 1 Region: 124-354,391-447
Classification Level Classification E-value
Superfamily MFS general substrate transporter 9.16e-48
Family LacY-like proton/sugar symporter 0.064
Further Details:      
 
Domain Number 2 Region: 567-709
Classification Level Classification E-value
Superfamily MFS general substrate transporter 1.15e-20
Family Glycerol-3-phosphate transporter 0.052
Further Details:      
 
Domain Number 3 Region: 472-550
Classification Level Classification E-value
Superfamily Pentapeptide repeat-like 0.0000000000144
Family Pentapeptide repeats 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000007227   Gene: ENSCPOG00000008032   Transcript: ENSCPOT00000008107
Sequence length 713
Comment pep:known_by_projection scaffold:cavPor3:scaffold_10:38488669:38565780:1 gene:ENSCPOG00000008032 transcript:ENSCPOT00000008107 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDNGYRNSPNLYHGARDIAREVTRQSRNQGMDDYKYQDNYEGYATSDGYYRGNESNPEED
AQSDVTEGHDEEDEIYEGEYQGIPHPDDIKAKQTKMAPSRADGLRGQADLMAERMEDEEQ
LAHQYETIIDECGHGRFQWILFFVLGLALMADGVEVFVVSFALPSAEKDMCLSSSKKGML
GLIVYLGMMAGAFVLGGLADKLGRKRVLSMSLAVNASFASLSSFVQGYGAFLFCRLISGI
GIGGSLPIVFAYFSEFLSREKRGEHLSWLGIFWMTGGLYAAAMAWSIIPHYGWGFSMGTN
YHFHSWRVFVIVCALPCTVSMVALKFMPESPRFLLEMGKHDEAWMILKQVHDTNMRAKGT
PEKVFTVSHIKTPKQMDEFIEIQSSTGTWYQRWLVRFKTTFKQVWDNALYCVMGPYRMNT
LILAVVWFTMALSYYGLIVWFPDMIRYFQDEEYKSKMKVFFGEHVYGATINFTMENQIHQ
HGKLINDKFTKMYFKHVLFEDTFFDECYFEDVTSTDTYFKNCTIESTVFYNTDLYKHKFI
NCHFINTTFLEQKEGCHMDFEEDNDFLIYLVSFLGSLSVLPGNIISALLMDRIGRLKMIG
GSMLISAVCCFFLFFGNSESAMIGWQCLFCGTSIAAWNALDVITVELYPTNQRATAFGIL
NGLCKFGAILGNTIFASFVGITKVVPILLAAASLVGGGLIALRLPETREQVLM
Download sequence
Identical sequences XP_003475310.1.53824 ENSCPOP00000007227 10141.ENSCPOP00000007227 ENSCPOP00000007227

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]