SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000007300 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000007300
Domain Number 1 Region: 447-700
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 5.16e-67
Family Eukaryotic proteases 0.0000000841
Further Details:      
 
Domain Number 2 Region: 23-141
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.31e-30
Family Spermadhesin, CUB domain 0.0000874
Further Details:      
 
Domain Number 3 Region: 192-304
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.26e-27
Family Spermadhesin, CUB domain 0.0000326
Further Details:      
 
Domain Number 4 Region: 376-456
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000431
Family Complement control module/SCR domain 0.0000232
Further Details:      
 
Domain Number 5 Region: 308-379
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000124
Family Complement control module/SCR domain 0.0000272
Further Details:      
 
Domain Number 6 Region: 138-190
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000234
Family EGF-type module 0.00046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000007300   Gene: ENSCPOG00000008118   Transcript: ENSCPOT00000008193
Sequence length 704
Comment pep:known_by_projection scaffold:cavPor3:scaffold_107:194048:201964:1 gene:ENSCPOG00000008118 transcript:ENSCPOT00000008193 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RWLLLLLAPALLCRVGGSVPIPQKFFGEVTSPLYPKPYPNNYETTTIITVPPGYRVKLVF
QQFDLEPSEGCLYDYVKISADKKNLGRFCGQLGSPLGNPPGKKEFVSKGNKMLLTFHTDF
SNEESGAIMFYKGFRAYYQAVDLNECASQSNSIEDDSQPRCQHLCHNYIGGYFCSCRAGY
ELREDRHSCQAECSSELYTEPSGYITSLEYPQPYPPDLRCNYSIRVERGFTLHLKFLEPF
EIDDHQQVHCPYDQLQIYANGKNIGEFCGTQRPPELDARSNAVDLLFFTDESGDSRGWKL
HYTTEIIKCPQPKPLDEFTVIQNPQTQYQFRDYFIVTCKKGYQLIEGDQALMSFSAVCQD
DGTWHRAMPRCKIRDCGQPRSLPNGDFRYITTKGVNVYESRIQYHCRGPYYKMKTRAGSN
ESERGLFTCTAQGTWKNEQEGEKIPRCLPVCGKPVHPEQRQRIISGQRARANFPWQVYTC
SPALGGGALLGDRWILTAAHTVHPKGQIKQDNNQSTEILLGHTHMKELRKLSNHPIHSIR
IHPDYRQDQPNNFDGDIALLELKNSVTLGPNILPICLPDNETFYDHSLMGYVSGFGLTED
RLPDSLRFVRIPVAERQLCESWLQSHKRDDVFSQNMFCAGGPTLKQDACQGDSGGVFVVK
DHKKDRWVATGIVSWGIGCGHGYGFYTKILSYVDWIKKEMGEEE
Download sequence
Identical sequences ENSCPOP00000007300 ENSCPOP00000007300 10141.ENSCPOP00000007300

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]