SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000007307 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000007307
Domain Number 1 Region: 532-564,639-712
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.0000000000001
Family Anti-sigma factor antagonist SpoIIaa 0.0067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000007307   Gene: ENSCPOG00000008126   Transcript: ENSCPOT00000008201
Sequence length 748
Comment pep:known_by_projection scaffold:cavPor3:scaffold_31:16777755:16804999:1 gene:ENSCPOG00000008126 transcript:ENSCPOT00000008201 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDHAEENEILAATQRYYVERPIFSHPVLQERLHEKDKVSDSIGDKLKRAFTCVVLYERSK
IRNIIYMFLPITKWLPAYKFKEYVLGDLVSGISTGVLQLPQGLAFAMLAAVPPVFGLYSS
FYPVIMYCFLGTSRHISIGPFAVISLMIGGVAVRLVPDDIVLPGGVNMTNGTEARDALRV
KVAMSVTLLSGIIQFCLGVCRFGFVAIYLTEPLVRGFTTAAAVHVFTSMLKYLFGVKTKR
HSGIFSVVYSTVAVLQNVKNLNVCSLGVGLMVFGLLLGGKEFNERFKEKLPAPIPLEFFA
VVMGTGISAGFNLQESYNVDVVGTLPLGLLPPANPDTSLFHLVYVDAIAIAIVGFSVTIS
MAKTLANKHGYQVDGNQELIALGLCNSIGSLFQTFSISCSLSRSLVQEGTGGKTQLAGCL
ASLMILLVILATGFLFESLPQAVLSAIVIVNLKGMFMQFSDLPFFWRTSKIELTIWLTTF
VSSLFLGLDYGLITAVIIALLTVIYRTQSPSYKVLGQLPDTDVYIDIDAYEEVKEIPGIK
IFQINAPIYYANSDLYSNALKRKTGVNPALIMGARRKAMRKYAKEVGNANMANATAVRVD
AEVDGEDGTKPEEEDGEVKYPPIVIKSTFPEELQRFMPQGDNIHTIILDFTQVNFVDSVG
VKTVAGIVKEYGDVGIYVYLAGCSAQVVNDLTRNRFFENPALKELLFYSIHDAVLGSQLR
EALAEQEATVAPPQEDMEPNATPATPEA
Download sequence
Identical sequences ENSCPOP00000007307 10141.ENSCPOP00000007307 ENSCPOP00000007307

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]