SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000007362 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000007362
Domain Number 1 Region: 198-316
Classification Level Classification E-value
Superfamily EF-hand 3.97e-35
Family Osteonectin 0.0087
Further Details:      
 
Domain Number 2 Region: 286-379
Classification Level Classification E-value
Superfamily Thyroglobulin type-1 domain 2.22e-25
Family Thyroglobulin type-1 domain 0.00073
Further Details:      
 
Domain Number 3 Region: 135-180
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.0000000000388
Family Ovomucoid domain III-like 0.007
Further Details:      
 
Weak hits

Sequence:  ENSCPOP00000007362
Domain Number - Region: 97-148
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 0.0428
Family Haloperoxidase 0.058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000007362   Gene: ENSCPOG00000008188   Transcript: ENSCPOT00000008263
Sequence length 391
Comment pep:known_by_projection scaffold:cavPor3:scaffold_15:21089995:21110811:-1 gene:ENSCPOG00000008188 transcript:ENSCPOT00000008263 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRAPGCGRLALPLLLLAAAALAEGDAKGLKEGETPGNFMEDEQWLSSISQYSGKIKHWNR
FRDEVEDDYIKSWEDNQQGDEALDTTKDPCQKVKCSRHKVCIAQGYQRAMCISRKKLEHR
IKQPTLKLHGNKDSICKPCHMAQLASVCGSDGHTYSSVCKLEQQACLSNKQLTVRCQGPC
PCPTEQAATSTADGKSDTCTGQDLADLGDRLRDWFQLLHENSKQNGSASSAASPAGGLDK
SLGASCKDAIGWMFSKLDTSADLFLDQTELAAINLDKYEVCIRPFFNSCDTYKDGRVSTA
EWCFCFWREKPPCLAELERIQIQEAVKKKPGIFIPSCDEDGYYRKMQCDQTSGDCWCVDQ
LGLELTGTRTHGNPDCDDIVGFSGDFGSGVG
Download sequence
Identical sequences 10141.ENSCPOP00000007362 ENSCPOP00000007362 ENSCPOP00000007362

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]