SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000007369 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000007369
Domain Number 1 Region: 778-832
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000109
Family Laminin-type module 0.0000555
Further Details:      
 
Domain Number 2 Region: 674-725
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000307
Family Laminin-type module 0.013
Further Details:      
 
Domain Number 3 Region: 236-294
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000254
Family Laminin-type module 0.044
Further Details:      
 
Domain Number 4 Region: 885-935
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000335
Family Laminin-type module 0.017
Further Details:      
 
Domain Number 5 Region: 834-882
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000053
Family Laminin-type module 0.00024
Further Details:      
 
Domain Number 6 Region: 397-447
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000446
Family Laminin-type module 0.01
Further Details:      
 
Domain Number 7 Region: 348-397
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000268
Family Laminin-type module 0.0079
Further Details:      
 
Domain Number 8 Region: 292-350
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000335
Family Laminin-type module 0.017
Further Details:      
 
Domain Number 9 Region: 723-780
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000013
Family Laminin-type module 0.00026
Further Details:      
 
Domain Number 10 Region: 933-978
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000201
Family Laminin-type module 0.019
Further Details:      
 
Domain Number 11 Region: 1021-1234
Classification Level Classification E-value
Superfamily Methyl-accepting chemotaxis protein (MCP) signaling domain 0.0000724
Family Methyl-accepting chemotaxis protein (MCP) signaling domain 0.0096
Further Details:      
 
Weak hits

Sequence:  ENSCPOP00000007369
Domain Number - Region: 1227-1477
Classification Level Classification E-value
Superfamily Tropomyosin 0.00235
Family Tropomyosin 0.0012
Further Details:      
 
Domain Number - Region: 50-128
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.00383
Family Galactose-binding domain 0.04
Further Details:      
 
Domain Number - Region: 638-676
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0837
Family Laminin-type module 0.053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000007369   Gene: ENSCPOG00000008195   Transcript: ENSCPOT00000008270
Sequence length 1559
Comment pep:known_by_projection scaffold:cavPor3:scaffold_12:1695031:1806816:-1 gene:ENSCPOG00000008195 transcript:ENSCPOT00000008270 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RCMPEFVTRLNVTVEAQHVWDSAREYCVQTGVTGVTKSCHLCDAGQPHLQHGAAFLTDYN
NQADTTWWQSQTMLSGVQYPSSINLTLHLGKAFDITYVRLKFHTSRPESFAIYKRTREDG
PWIPYQYYSGSCENTYAKANRGFIRTGEDEQQALCTDEFSDISPLTGGNVAFSTLEGRPS
AYNFDHSPVLQDWVTATDIRVTLNRLNTFGDEVFNDPKVLKSYYYAISDFAVGGRCKCNG
HASECVKNEFGKLVCNCKHNTYGVDCEKCLPFFNDRPWRRAIAQSPSECLPCDCNGRSQE
CYFDPELYRSTGHGGHCTNCRDNTDGANCERCRENFFRLGNKEACSPCHCSPVGSLSTQC
DSYGRCSCKPGVMGDKCDRCQPGFHSLTEAGCRPCSCDPSGSTDECNVETGRCVCKDNVE
GFNCERCKPGFFNLESSNPRGCTPCFCFGHSSVCTNAVGYSAYDVSSTFQIDEDGWRVEQ
RDGSEASLEWSSESQDISVISDSYFPRYFVAPAKFLGNQVLSYGQNLSFSFRVDRRDTRL
SAEDLVLEGAGLRVSVPLIAQGNSYPSETSGKYVFRLHEATDYPWRPTLTPFEFQKLLNN
LTSIKIRGTYSERSAGYLDDVTLASARPGPGVAATWVESCTCPAGYGGQFCEICLSGYRR
ETPSLGPYSPCVLCTCNGHSETCDPETGVCDCRDNTAGPHCERCSDGYYGDSTVGASSDC
QPCPCPGGSSCAVVPKTKEVVCTNCPVGTTGKRCELCDDGYFGDPQGNNGPVRLCRLCQC
NDNIDPNAVGNCNRLTGECLKCIYNTAGFYCDRCKDGFFGNPLAPNPADKCKDCSCNPYG
TVKQQRDCNPVTGQCECLPHVSGRDCAVCDPGFYNLQSGRGCERCDCHALGSTNGQCDIR
TGQCECQPGITGQHCERCEVNHFGFGPEGCKPCDCHPEGSLSLQCKDDGRCECREGFVGN
RCDQCEENYFYNRSWPGCQECPACYRLVKAKVADHRVKLQELESLIANLGTGDEMVTDQA
FEDRLKEAQREVNDLLREAQGVKDVDQNLMSRLQRVNNTLHSQISRLQNIRNTIEETGNL
AEQARARVESTEQLIEIASRELEKAKVAVANVSITQPESTGDPNNMTLLAEEARKLAERH
KQEADDIVRVAKTANDTSTEAYNLLLRTLAGENQTAVEIEELNRKYEQAKNISEDLEKQA
ARVHEEAKQAGDKAVEIYASVAQLAPVDSEALENEANKIKKEAADLDRLIDQKLKDYEDL
REDMSGKELEVKKLLESGKVEQQTADQLLARADAAKALAEEAAKKGRNTLQEANDILNNL
KDFDRRVNDNKTAAEEALKRIPAIDQTITEADEKTREARLALGSAAADAAEAKNKAHEAE
RIASAVQKNATSTKAEAEQTFTEVTDLDNEVNNMLRQLQEAEGELKRKQDAADQDMMMAG
MASQAAQEAEINARKAKNSVNNLLSMINDLLEQLGQLDTVDLNKINEIEGTLSKAKDEMK
ANDLDRKVSDLENEARKQEAAIMDYNRDIEEIMKDIRNLEDIKKTLPSGCFNTPSIEKP
Download sequence
Identical sequences ENSCPOP00000007369 10141.ENSCPOP00000007369 ENSCPOP00000007369

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]