SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000007378 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000007378
Domain Number 1 Region: 514-568
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000335
Family Laminin-type module 0.00022
Further Details:      
 
Domain Number 2 Region: 26-84
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000226
Family Laminin-type module 0.0086
Further Details:      
 
Domain Number 3 Region: 459-516
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000963
Family Laminin-type module 0.00083
Further Details:      
 
Domain Number 4 Region: 82-122
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000474
Family Laminin-type module 0.02
Further Details:      
 
Domain Number 5 Region: 142-187
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000642
Family Laminin-type module 0.014
Further Details:      
 
Weak hits

Sequence:  ENSCPOP00000007378
Domain Number - Region: 376-415
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00142
Family EGF-type module 0.09
Further Details:      
 
Domain Number - Region: 867-1075
Classification Level Classification E-value
Superfamily Tropomyosin 0.00785
Family Tropomyosin 0.011
Further Details:      
 
Domain Number - Region: 646-732
Classification Level Classification E-value
Superfamily Tropomyosin 0.0229
Family Tropomyosin 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000007378   Gene: ENSCPOG00000008204   Transcript: ENSCPOT00000008279
Sequence length 1188
Comment pep:known_by_projection scaffold:cavPor3:scaffold_12:1609541:1641805:-1 gene:ENSCPOG00000008204 transcript:ENSCPOT00000008279 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
WRGQCSNNCFSRFILKASSLPLSLVCDCNGKSQQCIFDQELHWRTGNGFRCLNCKDNTDG
LHCERCREGFYRRPDRDSCLPCNCHSKGSLSPLCDNFGWCSCKPGVTGDKCDRCLPGFHT
LGDAGCTQDQRQLDFKCDCDPAGIAGPCDSGRCVCKPAVTGERCDRCRAGYYHLDAGNPE
GCTQCFCYGHSASCHGSTDYSVHKITSTFQQDADGWKAVQRNGSSAKLHWSQRHRDVYTS
ARRDPVFFVAPAKFLGNQQVSYGQNLSFDYRVDRGGRHSSAHDVILEGAGLQITAPLIPH
GKILPCGITKTYTFRLNEHPSSNWSPQLSYFEYRRLLRNLTALRIRATYGEYSTGYIDNV
TLISARPVSGAPAPWVEHCVCPVGYKGQFCQDCASGYKRDAASLGPFGTCIPCNCQGGGT
CDPDTGDCYSGDENPDIECADCPLGFYNDPHDPRSCKPCPCHNGFSCSVMPETEEVVCNN
CPTGVTGARCELCADGYFGDPFGERGPVRPCQPCQCNNNVDPSASGNCDGLTGRCLKCIH
NTAGFNCDQCKAGYFGDPLAPNPANKCRACNCSPVGSEPGQCRSDGSCICKPGFGGLNCE
HRALPSCPACYSQVNTKMAQFMEQLQGLEALISKAQGGGGTIPNSELEGRLQQAEQALQD
ILREAQISEGASRSLRLQLANARGQESSYRNRLDDLKMTVERVQALGNQYQNRVRDTRRL
IAQMRLSMAENEASLRNSDIPSSDQYVGPNGFKSLAQEAVRLADSHVESANNMEQLVRET
ADYSKQALLLASKAQSGGVGSDITDNHAVQGLMGKLEKTKSLAQQLSREAAQTDTEADQS
HQHSLRLLDSVSQLQGVSDQSFKVEAKRIQQKVDSLSSLVARHTDEVKRVRSNLGNREKE
TQQLLQDGKNGRQKAGQLLSRANLAKSRAQEALSMGNATFYEVENILKNLREFDLQVEDR
KVEAEEAMKRLSYISRKVADASDKTEQAESALGSATADAQRANSAAREALEISGQMEQEI
GSLNLEANVTADGALAMEKGLATLKSEMREVEGELARKELEFDTDMDAVQMVITEAQRVD
ARAKNAGVTIQDALNSLDSILHLIDQPGSVDEEGLALLEQELFQTKTRINSQLRPLMSEL
EERARRQKNHLHFLEMSIDGILADVKNLENIRDNLPPGCYNTQALEQQ
Download sequence
Identical sequences ENSCPOP00000007378 10141.ENSCPOP00000007378 ENSCPOP00000007378

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]