SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000007381 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000007381
Domain Number 1 Region: 280-528
Classification Level Classification E-value
Superfamily SIS domain 4.67e-18
Family mono-SIS domain 0.0083
Further Details:      
 
Domain Number 2 Region: 29-200
Classification Level Classification E-value
Superfamily SIS domain 0.000000167
Family mono-SIS domain 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000007381   Gene: ENSCPOG00000008207   Transcript: ENSCPOT00000008282
Sequence length 625
Comment pep:known_by_projection scaffold:cavPor3:scaffold_18:9315790:9341258:1 gene:ENSCPOG00000008207 transcript:ENSCPOT00000008282 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPGTKRFQHVIETPEPGEWELSGYEAAVPITEKSNPLTRDLDKANAEKIVELLGQCDAEI
FQEEGQAMPAYQRLYSESVLTTMVQVAEKVQEILKEPDGGLVVLSGGGTSGRMAFLMSVS
FNQLMKGLGQKPLYTYLIAGGDRSVVASRERTEDSALHGIEELKKVAAGRRRVIVIGISV
GLSAPFVAGQMDYCMDNTAVFLPVLVGFNPVNMARNDPIEDWRSTFRQVAERMQKLQEKQ
EAFVLNPAVGPEGLSGCSRMKGGSATKILLETLLLAAHKTVDRGIAASQRCLLEILRTFE
RAHKVTYSQSSKIATLMKQVSTSLEKKGRVHLLGWQTLGIIAIMDGVECIHNFGADFRDI
RGFLIGDHSDMFNQKAELINQGPQFTFSQEDFLTSVLPSLTETDTVIFIFTLDDNLTQVQ
TLVEQVKEKTSSIQALTHSTVGQSLPAPLKKLFPSIINIMWPLLFFEYEGNFVQKFQREL
STKWVLNTVSTGAHVLLGKILQNHMLDLRIANSKLFWRALAMLQRFSGQSKARCIESLLQ
AIHFPQPLTDEIRAAPISTHVQAAHEKEQIIPVALLSLLFRCSIPAARAHAAAAPSVCEA
VRSALSGPGRKRSAEPREAVQPAAQ
Download sequence
Identical sequences ENSCPOP00000007381 10141.ENSCPOP00000007381 ENSCPOP00000007381 XP_003472922.1.53824

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]