SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000007469 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000007469
Domain Number 1 Region: 607-725
Classification Level Classification E-value
Superfamily Bromodomain 1.31e-38
Family Bromodomain 0.000000833
Further Details:      
 
Domain Number 2 Region: 403-552
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 1.98e-20
Family N-acetyl transferase, NAT 0.0000000499
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000007469   Gene: ENSCPOG00000008310   Transcript: ENSCPOT00000008385
Sequence length 731
Comment pep:known_by_projection scaffold:cavPor3:scaffold_0:76741777:76812060:-1 gene:ENSCPOG00000008310 transcript:ENSCPOT00000008385 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AEESCKCNGWKNPNPSPTPPRADLQHIIVSLTESCRSCSHALAAHVSHLENVSEEEMNRL
LGIVLDVEYLFTCVHKEEDADTKQVYFYLFKLLRKSILQRGKPVVEGSLEKKPPFEKPSI
EQGVNNFVQYKFSHLPSKERQTIVELAKMFLNRINYWHLEAPSQRRLRSPNDDISGYKEN
YTRWLCYCNVPQFCDSLPRYETTQVFGRTLLRSVFTVMRRQLLEQARQEKDKLPLEKRTL
ILTHFPKFLSMLEEEVYSQNSPIWDQDFLSVSSRTSQLGIQTVISPPPVAGTVSYNSNSS
SLEQPNGGSTSPACKASSGLEANPGEKRKMNDSHVLEEAKRPRVMGDIPMELINEVMSTI
TDPAAMLGPETNFLSAHSARDEAARLEERRGVIEFHVVGNSLNQKPNKRILMWLVGLQNV
FSHQLPRMPKEYITRLVFDPKHKTLALIKDGRVIGGICFRMFPSQGFTEIVFCAVTSNEQ
VKGYGTHLMNHLKEYHIKHDILNFLTYADEYAIGYFKKQGFSKEIKIPKTKYVGYIKDYE
GATLMGCELNPRIPYTEFSVIIKKQKEIIKKLIERKQAQIRKVYPGLSCFKDGVRQIPIE
SIPGIRETGWKPSGKDKSKEPRDPDQLYSTLKSILQQVKSHQSAWPFMEPVKRTEAPGYY
EVIRFPMDLKTMSERLKNRYYVSKKLFMADLQRVFTNCKEYNPPESEYYKCANILEKFFF
SKIKEAGLIDK
Download sequence
Identical sequences ENSCPOP00000007469 ENSCPOP00000007469 10141.ENSCPOP00000007469

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]