SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000007499 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000007499
Domain Number 1 Region: 894-1006
Classification Level Classification E-value
Superfamily SEA domain 1.83e-18
Family SEA domain 0.0089
Further Details:      
 
Domain Number 2 Region: 245-339
Classification Level Classification E-value
Superfamily SEA domain 0.0000000000131
Family SEA domain 0.0039
Further Details:      
 
Weak hits

Sequence:  ENSCPOP00000007499
Domain Number - Region: 1054-1096
Classification Level Classification E-value
Superfamily EGF/Laminin 0.023
Family EGF-type module 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000007499   Gene: ENSCPOG00000008342   Transcript: ENSCPOT00000008417
Sequence length 1240
Comment pep:known_by_projection scaffold:cavPor3:scaffold_35:3332226:3421824:-1 gene:ENSCPOG00000008342 transcript:ENSCPOT00000008417 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIMFPLLGKISLGILILVLIEGNLPSLTVQTYLSLEDIQEPKPAVSFLLPKESTDSSLPA
KKQQLLSHREIEKRWLLRRRRSILFPNGVKICRNETVTEAVASHMKYFKLRVCQEAVWEA
FKTFWDRLPGSKEYHYWMNLCEDGITSIFEMGTNFSQSVEHRSLIMKKLVHTKEMVSRPE
LSSPIPTGEPSTLGGAVLSVPYPGMSSHEGASESSLQSPEESISNEIVNVIEEPTKPAAE
QIAEFSIHLLGKQYRQDLQDPSSSYHKNLIEEFISEVENAFTGLPGYKDIHVLEFRSPKE
NGSHSGIDVHYEVTFNGEAISNTTWDLISLHSNKVENHGLVELDDKPTAVYTIGNFRDYI
AETLHQNLLVGNSSLNPDPESLQLINVRGVLLPQSEDLVWNTQSSSLQVAPPFILDSTLQ
GEWPSADEPATSNISPLDFSSGPSSTTDRELWPESPLADVVSTPKLAFPSEVVLSSSPED
LGVSSLTLHPVTPAVFQTGLPMASEGRTSGSYLLENDIFTISDERDFKSVDPLPSSSFIQ
PVPKQTVPPVENSGVSLTSSPEVTSPFSSDSLASEVKDQLEASHLFLDTSIEKEFIFESG
LGSGSGQKVDLISWPWSEISLKKSTEPLSRSWLEDEDSLLPTEGIDEKVVVESKIDYTDP
TIEHSKYKHDEKSTSFVVEESLVKPTVPIFAVSVIHSTSLTFPKHTSEIPNVDYHSVTKA
PFLLTAASSVITDETNTFLIKDVDQTTESSSHEWSDSKSSSVKPDLQPVWTIFPESAIAS
ARTSSQGISPRDSLASTPQSSDGLWLKTSMAQSTKLPPTTSSTFLEDEVIMGVQDISLEL
DRIGTDYYQPELIQEQNGKAGSYVEMFTSFHSTEMAILAQPTKGDDLGHARIEGALVVFF
SLRVTNMMFSEDLFNRNSLEYKALEQRFLELLVPYLQSNLTGFQNLEILNFRNGSIVVNS
RMKFAKSIPPDVNNAVYMILENFCTTAYQTMNLAIDKYSLDVESGDEANPCKFQACNEFS
ECLVNPWSGEAQCRCYPGYQSVDELPCQSLCDLQPDFCLNDGKCDILPGHGAICRCRVGE
NWWYRGEHCEEFVSEPLVIGITIASVVGILFVCSIIIFFLVKTLQDAHVRRERKCMFSGC
NFSRQPDSLSSMENAVKHNPAFDSHMAGCEQYEEPYPQHPFCGSASEEVIGGLSREEIRQ
MYESSGLSKEEIQERMRILELYANDPEFAAFVREHQITVT
Download sequence
Identical sequences 10141.ENSCPOP00000007499 ENSCPOP00000007499 ENSCPOP00000007499

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]