SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000007508 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000007508
Domain Number 1 Region: 411-818
Classification Level Classification E-value
Superfamily Phosphofructokinase 8.76e-111
Family Phosphofructokinase 0.00000763
Further Details:      
 
Domain Number 2 Region: 86-409
Classification Level Classification E-value
Superfamily Phosphofructokinase 7.06e-106
Family Phosphofructokinase 0.000000299
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000007508   Gene: ENSCPOG00000008351   Transcript: ENSCPOT00000008426
Sequence length 851
Comment pep:known_by_projection scaffold:cavPor3:scaffold_9:51686367:51727337:-1 gene:ENSCPOG00000008351 transcript:ENSCPOT00000008426 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHKEEFHLKFFMCVIQSRRLVRTPQRTAGETSNSSMLIPKLRPRTDTLKSLDTVDDPATM
EGIPIFKTEWIMTHEEHHAAKTLGIGKAIAVLTSGGDAQGMNAAVRAVVRVGIFTGARVF
FVHEGYQGLVDGGDNIREATWESVSMMLQLGGTVIGSARCKDFREREGRLRAAHNLVKRG
ITNLCVIGGDGSLTGADTFRSEWSDLLNDLQKAGKITAEEAKKSSFLNIVGLVGSIDNDF
CGTDMTIGTDSALHRIIEIVDAITTTAQSHQRTFVLEVMGRHCGYLALVTSLSCGADWVF
IPECPPDDDWEEHLCRRLSETRTRGSRLNIIIVAEGAIDKNGKPITSEDIKNLVVTRLGY
DTRVTVLGHVQRGGTPSAFDRILGSRMGVEAVMALLEGTPDTPACVVSLSGNQAVRLPLM
ECVQVTKDVTKAMDDKRFDEAMKLRGRSFMNNWEVYKLLAHVRPPVSKSGSFTVAVMNVG
APAAGMNAAVRSTVRIGLIQGNRVLVVHDGFEGLAKGQIEEAGWSYVGGWTGQGGSKLGT
KRTLPKKSFEQISANITKFNIQGLVIIGGFEAYTGGLELMEGRKQFDELCIPFVVIPATV
SNNVPGSDFSVGADTALNTICTTCDRIKQSAAGTKRRVFIIETMGGYCGYLATMAGLAAG
ADAAYIFEEPFTIRDLQANVEHLVQKMKTTVKRGLVLRNEKCNDNYTTDFIFNLYSEEGK
GIFDSRKNVLGHMQQGGSPTPFDRNFATKMGAKAMNWMSGKIKESYRNGRIFANTPDSGC
VLGMRKRALVFQPVTELKEQTDFEHRIPKEQWWLKLRPILKILAKYEIDLDTSEHAHLEH
ISRKRSGEATV
Download sequence
Identical sequences ENSCPOP00000007508 10141.ENSCPOP00000007508 ENSCPOP00000007508

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]