SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000007567 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000007567
Domain Number 1 Region: 1-393
Classification Level Classification E-value
Superfamily Integrin alpha N-terminal domain 1.83e-65
Family Integrin alpha N-terminal domain 0.00000349
Further Details:      
 
Domain Number 2 Region: 732-956
Classification Level Classification E-value
Superfamily Integrin domains 9.42e-56
Family Integrin domains 0.00042
Further Details:      
 
Domain Number 3 Region: 405-566
Classification Level Classification E-value
Superfamily Integrin domains 4.24e-35
Family Integrin domains 0.00056
Further Details:      
 
Domain Number 4 Region: 567-729
Classification Level Classification E-value
Superfamily Integrin domains 7.85e-28
Family Integrin domains 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000007567   Gene: ENSCPOG00000008418   Transcript: ENSCPOT00000008493
Sequence length 1030
Comment pep:known_by_projection scaffold:cavPor3:scaffold_3:17344019:17385802:-1 gene:ENSCPOG00000008418 transcript:ENSCPOT00000008493 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LLVGAPRAKALPRQRANRTGGLYSCDITSRGPCTRIEFDNDADPASESKEDQWMGVTVQS
QGPGGKVVTCAHRYEKRQHVNTKQESRDIFGRCYVLSQNLRIEDDMDGGDWSFCDGRLRG
HEKFGSCQQGVAATFTKDFHYIVFGAPGTYNWKVGIVRVEQKNNTFFDMNIFEDGPYEVG
GETDHDESLVPVPANSYLGFSLDSGKGIVSKDEITFVSGAPRANHSGAVVLLKRELKSAH
LLPEHIFDGEGLASSFGYDVAVVDLNKDGWQDIVIGAPQYFDRDGEIGGAAYVYINQQGR
WNNVKPIRLNGTKDSMFGIAVKNIGDINQDGYPDIAVGAPYDDMGKVFIYHGSANGINTK
PTQVLEGTTPSFGYSIAGNMDLDRNSYPDVAVLPSQISSIFRSRPVINIQKTITVTPSRI
DLRQKTCAAPSGICLKVKACFEYTAKPTGYNPPITIVGTLEAEKQRRKSGLSSRVQFRNQ
ASEPRYTQELTLQRQKQRLCMEETLWLQENIRDKLRPIPITASVEIQEPSSRRRVNSLPE
ILPILNSNEPTTVQTDVHFLKEGCGDDNVCNSNLKLEYKFCTREGNQDKFSYLPIQKGVP
ELVLKDQKDIALEITVTNIPSDPRNPKKDGDDAHEAKLIATFPDTLTYSAYRELRAFPEK
QLSCVANQNGSQADCELGNPFKRNSSVTFYLILSTTELTFDTTDLDINLKLETTSNQDNL
ASITAKAKVVIELLLSVSGVAKPSQVYFGGTVVGEQAMKSEDEVGSLIEYEFKVINLGKP
LKNLGSATLNIQWPKEISNGKWLLYLVKVESKGLEKIVCEPPDEINPLKLKESHKSRMKR
EIAEKQIDDRRKFSLFTERKYQTLNCSVNVKCVNIRCPLQGLDSKAALVLRSRLWNGTFL
EEYSKMNYLDILVRAYIEVTAAAGNIKLPHAGTQVRVTVFPSKTVAQYSGIPWWVILVSI
LAGILMLALLVIVLWKCGFFNRARYDDSVPRYYAVRIRKEEREIKDEKYNDNLVTSSWWC
SCRRESRSPH
Download sequence
Identical sequences ENSCPOP00000007567 ENSCPOP00000007567 10141.ENSCPOP00000007567

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]