SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000007738 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000007738
Domain Number 1 Region: 40-88
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 8.59e-16
Family Ovomucoid domain III-like 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000007738   Gene: ENSCPOG00000008611   Transcript: ENSCPOT00000008689
Sequence length 88
Comment pep:known scaffold:cavPor3:scaffold_6:10314466:10318654:-1 gene:ENSCPOG00000008611 transcript:ENSCPOT00000008689 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPFLRSWIKVIAILALAFFLSSEAAFAPSKVDSDRPNCSRYVQHLYMCTKELDPVCGTDG
HTYGNRCIFCSKQLESKGKFTFSHYGRC
Download sequence
Identical sequences Q91VF9
ENSCPOP00000007738 10141.ENSCPOP00000007738 ENSCPOP00000007738 NP_001166312.1.53824

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]