SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000007776 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000007776
Domain Number 1 Region: 13-161
Classification Level Classification E-value
Superfamily Troponin coil-coiled subunits 7.19e-51
Family Troponin I 0.00000259
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000007776   Gene: ENSCPOG00000008658   Transcript: ENSCPOT00000008736
Sequence length 182
Comment pep:known_by_projection scaffold:cavPor3:scaffold_42:12649941:12651408:-1 gene:ENSCPOG00000008658 transcript:ENSCPOT00000008736 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
WDSEEKRNRAITARRQHLKSVMLQIAATELEKEESRRETEKQNYLSEHCPPLHIPGSMSE
VQELCKQLHAKIDAAEEEKYDMEIKVQKSSKELEDMNQKLFDLRGKFKRPPLRRVRMSAD
AMLKALLGSKHKVCMDLRANLKQVKKEDTEKERDLRDVGDWRKNIEEKSGMEGRKKMFES
ES
Download sequence
Identical sequences ENSCPOP00000007776 10141.ENSCPOP00000007776 ENSCPOP00000007776

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]