SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000007830 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSCPOP00000007830
Domain Number - Region: 174-196
Classification Level Classification E-value
Superfamily EGF/Laminin 0.032
Family EGF-type module 0.058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000007830   Gene: ENSCPOG00000008722   Transcript: ENSCPOT00000008800
Sequence length 532
Comment pep:known_by_projection scaffold:cavPor3:scaffold_28:23441740:23443335:1 gene:ENSCPOG00000008722 transcript:ENSCPOT00000008800 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKMRRYKLFLMFCMAGLCLISFLHFFKTLSYVTFPRELASLSPNLVSSFFWNNAPVTPQA
SPEPGGPDLLRTPLYSHSPLLQPLPPSKAAEELHRVDFVLPEDTSEYFVRTKAGGVCFKP
GTKMLEKPPSGRPEEKPEGSEGSSGARGSARRPPRHMLSARERAGSSRGARRKWVECVCL
PGWHGPSCGVPTVVQYSNLPTKERLVPREVPRRVINAININHEFDLLAVRFHELGDVVDA
FVVCESNFTAYGEPRPLKFREMLTNGTFEYIRHKVLYVFLDHFPRGGRQDGWIADDYLRT
FLTQDGVSRLRNLRPDDVFIINDADEIPARDGVLFLKLYDGWTEPFAFHMRKSLYGFFWK
QPGTLEVVSGCTVDMLQAVYGLDGIRLRRRQYYTMPNFRQYENRTGHILVQWSLGSPLHF
AGWHCSWCFTPEGIYFKLVSAQNGDFPRWGDYEDKRDLNYIRSLIRTGGWFDGTKQEYPP
ADPSEHMYAPKYLLKNYNQFRYLLDNPYQEPKSTAVGGRRSKGPEAGHPQPG
Download sequence
Identical sequences ENSCPOP00000007830 10141.ENSCPOP00000007830 ENSCPOP00000007830

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]