SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000007861 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000007861
Domain Number 1 Region: 497-818
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 1.75e-110
Family PDEase 0.0000000000146
Further Details:      
 
Domain Number 2 Region: 108-302
Classification Level Classification E-value
Superfamily GAF domain-like 1.44e-44
Family GAF domain 0.0000845
Further Details:      
 
Domain Number 3 Region: 288-492
Classification Level Classification E-value
Superfamily GAF domain-like 5.67e-38
Family GAF domain 0.00045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000007861   Gene: ENSCPOG00000008756   Transcript: ENSCPOT00000008834
Sequence length 836
Comment pep:known_by_projection scaffold:cavPor3:scaffold_7:1336298:1435209:-1 gene:ENSCPOG00000008756 transcript:ENSCPOT00000008834 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QIPNGLHVLFCREMVNAWFAERVHTIPVCKEGARGHAESCSCPPQQSPRPDTSAPGTPTR
KISASEFDRPLRPIVVKDSEGTVSFLSDSEKKEQMPLTPPQFDSDEGDQCSRLLELVKDI
SSHLDVTALCHKIFLHIHGLIAADRYSLFLVCEDSSNDKFLISRLFDVAEGSTLEEASNN
CIRLEWNKGIVGHVAAFGEPLNIKDAYEDPRFNAEVDQITGYKTQSILCMPIKNHREEVV
GVAQAINKKSGNGGTFTEKDEKDFAAYLAFCGIVLHNAQLYETSLLENRRNQVLLDLASL
IFEEQQSLEVILKKIAATIISFMQVQKCTIFIVDEDCSDSFSSVFHMECEELEKTSDPLT
REHDANKINYMYAQYVKNTMEPLNIPDVSKDKRFPWTNENTGNVNQQCIRSLLCTPIKNG
KKNKVIGVCQLVNKMEENSGKVKPFNRNDEQFLEAFVIFCGLGIQNTQMYEAVERAMAKQ
MVTLEVLSYHASAAEEETRELQSLAAAVVPSAQTLKITDFSFSDFELSDLETALCTIRMF
TDLNLVQNFQMKYEVLCRWILSVKKNYRKNVAYHNWRHAFNTAQCMFAALKAGKIQSKLT
DLEILALLIAALSHDLDHRGVNNSYIQRSEHPLAQLYCHSIMEHHHFDQCLMILNSPGNQ
ILSGLSIEEYKTTLKIIKQAILATDLALYIKRRGEFFELIRKNQFDLEDPHQKELFLAML
MTACDLSAITKPWPIQQRIAELVATEFFDQGDRERKELNIEPTDLMNREKKNKIPSMQVG
FIDAICLQLYEALTHVSEDCKPLLDGCRKNRQKWQALAEQQEKTMVNGENSQAKRN
Download sequence
Identical sequences 10141.ENSCPOP00000007861 ENSCPOP00000007861 ENSCPOP00000007861

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]