SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000007948 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000007948
Domain Number 1 Region: 145-331
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.48e-38
Family Laminin G-like module 0.0035
Further Details:      
 
Domain Number 2 Region: 34-171
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 7.65e-36
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.00081
Further Details:      
 
Domain Number 3 Region: 334-514
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.58e-33
Family Laminin G-like module 0.0039
Further Details:      
 
Domain Number 4 Region: 968-1021,1062-1196
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.88e-33
Family Laminin G-like module 0.0036
Further Details:      
 
Domain Number 5 Region: 778-960
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.78e-28
Family Laminin G-like module 0.0065
Further Details:      
 
Domain Number 6 Region: 572-629
Classification Level Classification E-value
Superfamily Fibrinogen C-terminal domain-like 0.00000000013
Family Fibrinogen C-terminal domain-like 0.0027
Further Details:      
 
Domain Number 7 Region: 543-579
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000164
Family EGF-type module 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000007948   Gene: ENSCPOG00000008851   Transcript: ENSCPOT00000008931
Sequence length 1339
Comment pep:known_by_projection scaffold:cavPor3:scaffold_53:12355909:12366675:1 gene:ENSCPOG00000008851 transcript:ENSCPOT00000008931 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KMRLRLLCVLLAAAASTARGWGYYGCDEELVGPLYARSLGASSSYGLFTTARFARLHGIS
GWSPRIGDPNPWLQIDLMKKHRIRAVATQGSFNSWDWVTRYMLLYGDRVDSWTPFYQQGH
NATFFGNVNESAVVRHDLHFHFTARYVRIVPLAWNPRGKIGLRLGLYGCPYKSDVLYFDG
DDAISYRFPRGVSRSLWDVIAFSFKTEEKDGLLLHSEGAQGDYVTLELQGAHLLLHMSLG
SSPIQPRPGHTTVSAGGVLNDQHWHYVRLDRYGREANLTLDGYAQHFLLNGDFERLNLDT
EMFIGGLVGAAQKNLAYRHNFRGCIENIIFNRVNIADLAVRRHHRITFEGKVAFRCLDPV
PHPINFGGPHNFIQVPGFPRRGRLAVSFRFRTWDLTGLLLYSSLGDGLGHVELMLSEGQV
NVSIAQTGRKRLQFAAGYRLNDGFWHEVNFVAQENHAVISIDDVEGAEVRVSYPLLIRTG
TSYFFGGCPKPASQWGCHSNQTAFHGCMELLKVDGQLVNLTLVEFRRLGYYAEVLFDTCG
ITDRCSPNMCEHDGRCYQSWDDFICYCELTGYKGETCHQPLYKESCEAYRLSGKTSGNFT
IDPDGSGPLKPFVVYCDIRENRAWTVVRHDRLWTTRVSGSSMERPFLAAVQYWNASWEEV
SALANASQHCEQWIEFSCYNSRLLNTAGGYPYSFWIGRHEEQHFYWGGSQPGIQRCACGL
DHSCVDPALHCNCDADQPQWRTDKGLLTFVDHLPVTQVVVGDTNRSNSEAQFFLRPLRCY
GDRNSWNTISFHTGAALRFPPIRANHSLDVSFYFRTSAPSGVFLENQSGRYCQWRRPYLR
VELNTSRDVVFAFDVGNGDENLTAHSEDLEFSDDEWHLVRAEINVKQARLRVDHRPWVVR
PMPPQTYLWLEYDQPLYVGSAELKRRPFVGCLRAMRLNGVTLNLEGRANASEGTSPNCTG
RCAHPRFPCSHGGRCVERYSYYTCDCDLTAFDGPYCNHDIGGFFEPGTWMRYNLQSALRS
AAREFSHMLSRPVPGYERLPDYPRPGRPVPGYRGPVYNVTGEEVSFSFSTSSAPAVLLYV
SSFVRDYMAVLIKEDGTLQLRYQLGTSPYVYPLTTRPVTDGQPHSVNITRVYRNLFIQVD
YFPLTEQKFSLLVDSQLDSPKALYLGRVMETGVIDPEIQRYNSPGFSGCLSGVRFNNVAP
LKTHFRSPRPMTAELAEALRVQGELAESNCGAMPRLVAEVPPELDPWYLPPDFLYYHDDG
WVAILLGFLVAFLLLGLVGMLVLFYLQHHRYKGSYHTNEPKATHDYQPRSKTPLPTQGVA
RAPSPEASSTWGFSALPAP
Download sequence
Identical sequences 10141.ENSCPOP00000007948 ENSCPOP00000007948 ENSCPOP00000007948

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]