SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000007973 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000007973
Domain Number 1 Region: 120-233
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 2.49e-24
Family Synaptotagmin-like (S variant) 0.018
Further Details:      
 
Domain Number 2 Region: 360-451
Classification Level Classification E-value
Superfamily vWA-like 0.00000000000106
Family Integrin A (or I) domain 0.012
Further Details:      
 
Domain Number 3 Region: 4-73
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 0.0000000000811
Family Synaptotagmin-like (S variant) 0.047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000007973   Gene: ENSCPOG00000008877   Transcript: ENSCPOT00000008957
Sequence length 527
Comment pep:known_by_projection scaffold:cavPor3:scaffold_54:1489558:1651923:1 gene:ENSCPOG00000008877 transcript:ENSCPOT00000008957 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
YREFGRTEVIDNTLNPDFVRKFILDYFFEERENLRFDLYDVDSKSPNLSKHDFLGQVFCT
LGEIVGSQGSRLEKPIVVGIIKLNTLKFKPLVIFQEIGIPGRKCGTIILTAEELNCCRDA
VLMQFCANKLDKKDFFGKSDPFLVFYRSNEDGSFTICHRTEVVKNTLNPVWQAFKISVRA
LCNGDYDRDRTIKVEVYDWDRDGSHDFIGEFTTSYRELSRGQSQFNVYEVINTKNNISDE
RLYINSGTVTLLSFLVETEVSFLDYIKGGTQINFTVAIDFTASNGKKIQGTYIYLGTNNL
NSFTDILLYIGKTVRHDQVAKSLPTLEVSSKXPRDGHFSYNFLQNGNPQNPYCDGIEGVM
EAYYRSLKSVQLYGPTNFAPVINHVARYASSVKDGSQYFVLLIVTDGVISDMAQTKESIV
NASKLPMSIIIVGVGPAEFDAMVELDGDDVRVSSRGKYAERDIVQFVPFRDYIDRSGNHI
LSMARLAKDVLAEIPEQFLSYMRARGIKPSPAPPPYTPPTHALQTQI
Download sequence
Identical sequences 10141.ENSCPOP00000007973 ENSCPOP00000007973 ENSCPOP00000007973

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]