SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000007999 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000007999
Domain Number 1 Region: 427-682
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.11e-70
Family Eukaryotic proteases 0.000000185
Further Details:      
 
Domain Number 2 Region: 19-131
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 4.45e-30
Family Spermadhesin, CUB domain 0.00000146
Further Details:      
 
Domain Number 3 Region: 175-288
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 7.72e-24
Family Spermadhesin, CUB domain 0.0000607
Further Details:      
 
Domain Number 4 Region: 360-431
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000111
Family Complement control module/SCR domain 0.0000584
Further Details:      
 
Domain Number 5 Region: 299-369
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000278
Family Complement control module/SCR domain 0.0021
Further Details:      
 
Domain Number 6 Region: 127-171
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000914
Family EGF-type module 0.00035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000007999   Gene: ENSCPOG00000008905   Transcript: ENSCPOT00000008985
Sequence length 690
Comment pep:known_by_projection scaffold:cavPor3:scaffold_107:229175:238105:-1 gene:ENSCPOG00000008905 transcript:ENSCPOT00000008985 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LRCVVLFSLWAWAYAEPTLHGEILSPNYPQAYPNDVKQTWDVEVPEGFGIHLYFTHLDIE
LSENCLYDSVKIVSGGIEEGKLCGQRTSKNPKSPIIEEFHIPYNKLQVTFTSDFSNEERY
TGFAAYYVAVDVNECTDFADVPCSHFCNNFIGGYFCSCPPEYFLHDDKRNCGAVNCSGDV
FTTLIGEIASPNYPEAYPENSRCEYQIQLEEGFQVVMTLKREDFDVEPADSEGNCRDSLE
FVTRRQRFGPYCGNGFPGPLTIETKSNTVDIIFQTDLTGQNKGWKLRYHGDPIPCPKEVP
ANTIWEPEKPKYVFKDVVKITCLEGFEIVEGGSDPMSLYSTCLSNGMWSNSKARCQPVDC
GEPEPIRNGKVQMPAETLFGSVFRYTCEEPYYYMEHEESGTEYRCSGNGSWVNEVLGTEL
PKCVPVCGVPSKPFTTSQRIFGGSIADIASFPWQVFFHSERAGGALIDEYWVLTAAHVVE
RNYHPTMYTGLNLTKSSLLAKTHSLAAESVFIHPDWQRVDDPSMRTNFDNDIALIRLKQP
VKMGPAVSPICLPGASLNYSLSVGDLGMISGWGKTEKRDWVVQLRGAVLPVTALEMCQGV
RPKNPKLDPKSYIFTENMFCAGGSGVDSCQGDSGGAFVVKRLIENRSKFYVFGVVSWGIE
CGTYGVYTKVQNYVEWIRRTMKEYSTPLQD
Download sequence
Identical sequences ENSCPOP00000007999 10141.ENSCPOP00000007999 ENSCPOP00000007999

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]