SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000008015 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000008015
Domain Number 1 Region: 1-253,352-426
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 3.98e-79
Family Succinate dehydrogenase/fumarate reductase flavoprotein N-terminal domain 0.000000346
Further Details:      
 
Domain Number 2 Region: 230-348
Classification Level Classification E-value
Superfamily Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain 3.74e-42
Family Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain 0.00000613
Further Details:      
 
Domain Number 3 Region: 443-543
Classification Level Classification E-value
Superfamily Succinate dehydrogenase/fumarate reductase flavoprotein C-terminal domain 2.35e-34
Family Succinate dehydrogenase/fumarate reductase flavoprotein C-terminal domain 0.00056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000008015   Gene: ENSCPOG00000008921   Transcript: ENSCPOT00000009002
Sequence length 548
Comment pep:known_by_projection scaffold:cavPor3:scaffold_150:1972806:1991339:-1 gene:ENSCPOG00000008921 transcript:ENSCPOT00000009002 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EFDAVVVGAGGAGLRAAFGLSEAGFNTACLTKLFPTRSHTVAAQGGINAALGNMEEDNWR
WHFYDTVKGSDWLGDQDAIHYMTEQAPASVIELENYGMPFSRTEDGRIYQRAFGGQSLKF
GKGGQAHRCCCVADRTGHSLLHTLYGRSLRYDTSYFVEYFALDLLMENGECRGVIALCIE
DGSIHRIRAKNTVIATGGYGRTYFSCTSAHTSTGDGTAMVTRAGLPCQDLEFVQFHPTGI
YGAGCLITEGCRGEGGILINSEGERFMERYAPVAKDLASRDVVSRSMTLEIREGRGCGPE
KDHVFLQLHHLPPEQLATRLPGISETAMIFAGVDVTKEPIPVLPTVHYNMGGIPTNYKGQ
VLKHVNGQDQVVPGLYACGEAACASVHGANRLGANSLLDLVVFGRACALSIAESCRPGDK
VPPIKPNAGEESVMNLDKLRFADGNIKTSELRLNMQKTMQTHAAVFRVGSVLQEGCEKIS
QLYGDLQHLKTFDRGMVWNTDLVETLELQNLMLCALQTIYGAEARKESRGAHAREDYKVR
IDEYDYSK
Download sequence
Identical sequences ENSCPOP00000008015

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]