SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000008016 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000008016
Domain Number 1 Region: 395-751
Classification Level Classification E-value
Superfamily Hect, E3 ligase catalytic domain 1.96e-112
Family Hect, E3 ligase catalytic domain 0.0000000496
Further Details:      
 
Weak hits

Sequence:  ENSCPOP00000008016
Domain Number - Region: 115-179
Classification Level Classification E-value
Superfamily Globin-like 0.0347
Family Globins 0.076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000008016   Gene: ENSCPOG00000008922   Transcript: ENSCPOT00000009003
Sequence length 757
Comment pep:known_by_projection scaffold:cavPor3:scaffold_137:1545376:1607752:1 gene:ENSCPOG00000008922 transcript:ENSCPOT00000009003 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AAEEKKAKELEREKLPPIVSAAAGATAGLDKGAKGQISTLSSVLSTVSQKKEAAENRSSP
THLILPNIKNGNVKEPVCLDVRQKQRISIDALSPEMKAPAFPEPVLPVQPKTMKDFQEDI
EKVKSSGDWKTVHDFYLTTFDSFPELNAVFKRDATASFNTIEDSGVNAKFVNVVYDALLN
TPQDIQKTVLKGIINSLLREWKGPRTKDDLRAYFILLQNPQFNNTSTYVIYAHLLRQIAA
LVEADHHFLVHWLKKLSQKRFKQLVERLLQFISLRLFPAKPEEFPPITKCSWWIPSASKV
LALLNTANSLIQPPLIPYTDFYNSTLDHIDLMEEYHTWQSFGNSHRFSFCQYPFVISIAA
KKIIIQRDSEQQMISIARQSLVDKVSRRQRPDMNMLFLNMKVRRTHLVSDSLDELTRKRA
DLKKKLKVTFVGEAGLDMGGLTKEWFLLLIRQIFHPDYGMFTYHKDSHCHWFSSFKCDNY
SEFRLVGILMGLAVYNSITLDIRFPPCCYKKLLSPPIVPGDQNIPVGICSVTIDDLCQIM
PELAHGLSELLSYEGNVEEDFYSTFQVFQEEFGIIKSYNLKPGGDKIPVTNQNRKEYVQL
YTDFLLNKSIYKQFAAFYYGFHSVCASNALMLLRPEEVEILVCGSPELDMHALQRSTQYD
GYAKTDLTIRYFWDVVLGFPLDLQKKLLHFTTGSDRVPVGGMADLNFKISKNETSTNWLP
VAHTCFNQLCLPPYKSKKDLKQKLIIGISNSEGFGLE
Download sequence
Identical sequences 10141.ENSCPOP00000008016 ENSCPOP00000008016 ENSCPOP00000008016

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]