SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000008029 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000008029
Domain Number 1 Region: 56-226
Classification Level Classification E-value
Superfamily vWA-like 2.23e-18
Family Integrin A (or I) domain 0.024
Further Details:      
 
Domain Number 2 Region: 323-385
Classification Level Classification E-value
Superfamily Cysteine-rich domain 1.26e-17
Family TFIIH p44 subunit cysteine-rich domain 0.00022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000008029   Gene: ENSCPOG00000008936   Transcript: ENSCPOT00000009017
Sequence length 395
Comment pep:novel scaffold:cavPor3:scaffold_29:6273414:6289301:-1 gene:ENSCPOG00000008936 transcript:ENSCPOT00000009017 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDEEPERTKRWEGGYERTWEILKEDESGSLKATIEDILFKAKRKRVFEHHGQVRLGMMRH
LYVVIDGSRTMEDQDLKPNRLTCTLKLLEYFVEEYFDQNPISQIGIIVTKSKRAEKLTEL
SGNPRKHITSLKKAIDMTCHGEPSLYNSLSMAMQTLKHMPGHTSREVLIIFSSLTTCDPS
NIYDLIKTLKAAKIRVSVIGLSAEVRVCTALARETGGTYHVILDESHYKELLTHHVSPPP
ASSSSECSLIRMGFPQHTIAALSDQDAKPSFSMAHLDSSSEPGLTLGGYFCPQCRAKYCE
LPVECKICGLTLVSAPHLARSYHHLFPLDAFQEIPLEEYKGERFCYGCQGQLKDQHVYVC
TVCQNVFCVDCDVFVHDSLHCCPGCIHKIPIPSGI
Download sequence
Identical sequences A0A286XJ67
XP_003470305.1.53824 10141.ENSCPOP00000008029 ENSCPOP00000008029 ENSCPOP00000008029

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]