SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000008062 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000008062
Domain Number 1 Region: 313-429
Classification Level Classification E-value
Superfamily EF-hand 1.77e-31
Family Osteonectin 0.0087
Further Details:      
 
Domain Number 2 Region: 224-294
Classification Level Classification E-value
Superfamily Thyroglobulin type-1 domain 1.96e-20
Family Thyroglobulin type-1 domain 0.0016
Further Details:      
 
Domain Number 3 Region: 89-161
Classification Level Classification E-value
Superfamily Thyroglobulin type-1 domain 4.45e-19
Family Thyroglobulin type-1 domain 0.0014
Further Details:      
 
Domain Number 4 Region: 43-88
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.000000000152
Family Ovomucoid domain III-like 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000008062   Gene: ENSCPOG00000008973   Transcript: ENSCPOT00000009055
Sequence length 430
Comment pep:known_by_projection scaffold:cavPor3:scaffold_20:14473053:14612824:1 gene:ENSCPOG00000008973 transcript:ENSCPOT00000009055 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLPARCVRLLTPHLLLVLVQLSPARGHRTTGPRFLISDRDPQCNLHCSRTQPKPICASDG
RSYESMCEYQQAKCRDPTLSVAHRGRCKDAGQSKCRLERAQALEQAKKPQEAVFVPECGE
DGSFTQVQCHTFTGYCWCVTPDGKPISGSSVQNKTPVCSGSVTDKPSSQVNSGKKDDGSK
PTPTMETQPVFDGDEITAPTLWIKHLVIKDSKLNNTNVRNSEKVHSCDQERQSALEEARQ
NPREGIVIPECAPGGLYKPVQCHQSTGYCWCVLVDTGRPLPGTSTRYVMPSCESDARAKS
TEVEDPFKDRELPGCPEGKKMEFITSLLDALTTDMVQAINSAAPTGGGRFSEPDPSHTLE
ERVVHWYFSQLDSNSSNDINKREMKPFKRYVKKKAKPKKCARRFTDYCDLNKDKVISLPE
LKGCLGVSKE
Download sequence
Identical sequences ENSCPOP00000008062 10141.ENSCPOP00000008062 ENSCPOP00000008062

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]