SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000008127 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000008127
Domain Number 1 Region: 1249-1456
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 6.48e-45
Family Laminin G-like module 0.00026
Further Details:      
 
Domain Number 2 Region: 1740-1965
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.71e-36
Family Laminin G-like module 0.000000771
Further Details:      
 
Domain Number 3 Region: 1507-1704
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 6.53e-30
Family Laminin G-like module 0.00053
Further Details:      
 
Domain Number 4 Region: 366-433
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 9.7e-18
Family Ovomucoid domain III-like 0.0074
Further Details:      
 
Domain Number 5 Region: 449-498
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.0000000000000596
Family Ovomucoid domain III-like 0.0083
Further Details:      
 
Domain Number 6 Region: 92-140
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.000000000000152
Family Ovomucoid domain III-like 0.0056
Further Details:      
 
Domain Number 7 Region: 1046-1122
Classification Level Classification E-value
Superfamily SEA domain 0.000000000000968
Family SEA domain 0.0026
Further Details:      
 
Domain Number 8 Region: 799-868
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.00000000000139
Family Ovomucoid domain III-like 0.0084
Further Details:      
 
Domain Number 9 Region: 597-648
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.00000000000152
Family Ovomucoid domain III-like 0.004
Further Details:      
 
Domain Number 10 Region: 514-563
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.00000000000236
Family Ovomucoid domain III-like 0.0088
Further Details:      
 
Domain Number 11 Region: 146-216
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.0000000000444
Family Ovomucoid domain III-like 0.0064
Further Details:      
 
Domain Number 12 Region: 229-287
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.0000000000444
Family Ovomucoid domain III-like 0.0095
Further Details:      
 
Domain Number 13 Region: 296-359
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.0000000000596
Family Ovomucoid domain III-like 0.006
Further Details:      
 
Domain Number 14 Region: 691-734
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000977
Family Laminin-type module 0.0042
Further Details:      
 
Domain Number 15 Region: 745-782
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000419
Family Laminin-type module 0.017
Further Details:      
 
Weak hits

Sequence:  ENSCPOP00000008127
Domain Number - Region: 1449-1484
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000121
Family EGF-type module 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000008127   Gene: ENSCPOG00000009046   Transcript: ENSCPOT00000009129
Sequence length 1967
Comment pep:known_by_projection scaffold:cavPor3:scaffold_186:1232725:1251927:-1 gene:ENSCPOG00000009046 transcript:ENSCPOT00000009129 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPPLPLERRPGLQPGVSVLVRYFMVPCNACLILLATSTLGFAVLLFLSNYKLGTHFTPAP
LMLLTPTPVCRGMLCGFGAVCEPSIEDPGRASCVCKKNACPAVVAPVCGSDASTYSNECE
LQRAQCVLQRRIRLLRRGPCGFRDPCTNVTCSFGSTCARSADGQTATCLCPVTCHGAPEG
TVCGSDGANYPSECQLLHHACTRQENISKKFDGPCDPCQEAFTDLSHICRVNPRTRRPEM
LLRPDSCPPRHSPVCGDDGVTYENDCIMGRTGAVQGLLLQKVRSGQCQPRDQCPEACQFG
AVCLSRRGRPRCSCDRVTCDGAYKPVCAQDGHTYDNDCLRQQAECRQQRAIPPKHQGLCA
QAPSPCHEVQCAFGATCAVKNGKAVCECQQVCTGIYDPVCGSDGITYGSMCELGAMACAL
GQEIRVTRRGPCDQCGQCRFGALCEAETGRCVCPSECVASAQPVCGSDGHTYASECELHV
HACTQQVDLHVISAGPCQTCKDTVCAFGAVCSAGQCVCPRCEHPPPGPVCGSDGITYPSA
CELREAACRQQVQIEEARAGPCEQAECGSGGSGSGEEGECERELCQQRGGIWDEDSEDGP
CVCDFSCQSVLRSPVCGSDGVTYGTECDLKKARCESQRELYVAAQGPCHSPTLAPLPPVF
LSHCAQTPYGCCQDNVTAARGVGLAGCPSTCQCNPHGSYSGTCDPATGQCSCRPGVGGLK
CDRCEPGFWNFRGIVTDNLSGCTPCSCDPQGAVRDDCEQMTGLCSCKPGVAGPKCGQCPD
GQTLGPTGCEAGSLMPKTCVEMHCEFGASCVEEAGSARCACPALTCPEANATKVCGSDGI
TYGNECQLKTIACRQGLDIFTQSVGPCQDAVALGVYPTSVSMTTLEHVLNEALPSPSSAL
SLAPSSIPRSQATPLPTSRPWTTSSIPRPTARPGPVLTMPPTTTSTTASLPASAFGESGS
TNGSGDEELSGDQEASGGGSGGLELPMGNNIVTAGPPIERASCYNSPLGCCSDGKTPSLD
AESSNCPATKAFQGVLELEGVEGQELFYTPEMADPKSELFGETARSIENSLDDLFRNSDV
KKDFRSVRLRDLGPGRSVRAIVDVHFDPTTAFRAPDVGQALLRQIQASRRRTLLVRRPLH
EHVRFMDFDWFPAFFTGAATGATAAVATARATTTGQLPSAVTPRAYPSHTSRPTGKTTAP
LTTRRPLTTLPSRMAGHQPIPPDPQQPLRPCASQPCLYGGTCWDQDSGQGFTCSCPAGRG
GIICEEVLRPSLPAFGGHSFLAFPTLRAYHTLRLALEFRTLELQGLLLYNGNNRGKDFLA
LALQGGRVQLRFDTGSGPAVLTSSVPVKLGRWHRLELSRHWRQGTLSVDGESPVVGESPS
GTDGLNLDTDLFVGGVPEDQAAVVLERTFVAVGLKGCIRLLDINNQRLELGSWQGASTQS
SGVGECGENPCVPNPCSSGAPCQALDDGMFHCQCPPGRFGLTCASEKNPCQPNPCHGAAP
CRVLPEGGPKCECPLGRGGALCQTDLEKDHGSQPFMADFSGFSYLELKGLYTFERDLGEK
MALEVVFLARGPSGLLLYNGQKTDGRGDFVSLALRDWHLEFRYDLGKGPAVIRSKEPVAV
DTWTRVSLERNGRKGAMRVGDGPRVLGESPKSRKVPHTVLNLKEPLYVGGAPDFSRLARA
AAVSSGFDGAIQLVSLGGRQLLTQEHVLQAVGISSFADHPCTQASGHPCLNGASCLPQEA
TYECLCPSGFSGLHCEKGLVEKSAGDLDTLAFDGQTYIEYLNAVRESKLANEIPFPEAPD
SGSFHSEKALQSNHFELSLRTEATQGLVLWSGKATERADYVALAIVDGYLQLSYDLGSQP
VVLRSTVKVNTNHWLRVKAHREQREGSLQVGNEAPVTGSSPLGSTQLDTDGALWLGGLQK
LPVGQALPKAYSTGFVGCLRDVVVSGRPLHLLEDAVTRPELRPCPAP
Download sequence
Identical sequences ENSCPOP00000008127 ENSCPOP00000008127 10141.ENSCPOP00000008127

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]