SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000008221 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000008221
Domain Number 1 Region: 97-379
Classification Level Classification E-value
Superfamily L domain-like 3.4e-49
Family Ngr ectodomain-like 0.0081
Further Details:      
 
Domain Number 2 Region: 395-702
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 6.59e-43
Family Rhodopsin-like 0.00032
Further Details:      
 
Domain Number 3 Region: 24-64
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000157
Family LDL receptor-like module 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000008221   Gene: ENSCPOG00000009157   Transcript: ENSCPOT00000009240
Sequence length 738
Comment pep:known_by_projection scaffold:cavPor3:scaffold_6:33226651:33270212:1 gene:ENSCPOG00000009157 transcript:ENSCPOT00000009240 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VWLMLDLIAIISNVKNVALTESGMIIPLCQKGYFPCGNLTKCLPRAFHCDGVDDCGNGAD
EKNCGDTSGWATIFGTVHGNVNNVTLTQECFLNHYPEHCDCRETELECVNAGLKSVPTIS
SNVTLLSLKKNKIHSLPDKVFIKYTELKKIFLQHNCIRHISRKAFFGLYNLQILYLNHNS
ITTLRPGIFKDLHQLTWLILDDNPITRISQQLFTGLNSLFFLSMVNNYLEVLPQQICAHM
PQLSWMDLEANRIKHLTNSTFLSCKSLSVLFLPRNQIDFVPEKTFSSLKNLGELDLSSNM
MTELPPHLFKDLKLLQKLNLSSNPLLYLHKNQFGSLKQLQSLDLRRIEIPNINTEMFQPL
KNLSHIYFKNFRYCSYAPHVRLCMPLSDGISSFEDLLANNILRIFVWVIAFITCFGNLFV
IGMRSFIKAENTTHAMSIKILCCADCLMGIYLFFVGFFDIKYRGQYQKYALLWMESPQCH
LLGFLAMLSTEVSVLLLTFLTLEKFLVVVFPFSNIRPGKRQTLVILSCIWMVGFLIAVIP
FWNDNYFGNFYGKNGVCFPLYYDHTEATGSQVYSLGIFLGVNLLAFVIIVFCYIIMFCSI
QKTAAQTAEVRNHIGKEVAIANRFFFIVFSDAICWIPVFVVKILSLLRVEIPGTITSWIV
IFFLPVNSALNPILYTLTTSFFKDKLKQMLSKHRRKSIFEIKKRSLSASIVWTDDSSSLK
LGVLNKITFGDSIMKPVP
Download sequence
Identical sequences ENSCPOP00000008221 ENSCPOP00000008221 10141.ENSCPOP00000008221

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]