SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000008258 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000008258
Domain Number 1 Region: 54-129
Classification Level Classification E-value
Superfamily Ribosomal protein S18 2.49e-25
Family Ribosomal protein S18 0.00081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000008258   Gene: ENSCPOG00000009198   Transcript: ENSCPOT00000009281
Sequence length 144
Comment pep:known_by_projection scaffold:cavPor3:scaffold_33:4934868:4942560:-1 gene:ENSCPOG00000009198 transcript:ENSCPOT00000009281 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAVVTVCSGLGRKKLTHWVTSAVGLTDPGTHRVLWRRGCSQYKQVTSDENLPTTMENPY
KEPLKKCILCGKRVDYKNVQLLSQFISAYTGCIHGRHITGLCGKKQKEISKAIKRAQVMG
FMPVTHKDPAYLKDPKVCNIKYRE
Download sequence
Identical sequences H0VE30
ENSCPOP00000008258 XP_003469464.1.53824 ENSCPOP00000008258 10141.ENSCPOP00000008258

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]