SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000008393 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000008393
Domain Number 1 Region: 41-276
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 6.8e-35
Family N-acetyl transferase, NAT 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000008393   Gene: ENSCPOG00000009351   Transcript: ENSCPOT00000009436
Sequence length 297
Comment pep:known_by_projection scaffold:cavPor3:scaffold_86:1672299:1679162:1 gene:ENSCPOG00000009351 transcript:ENSCPOT00000009436 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KMFPLQGAQMLQMLEKSLIKRIPASLKVYGTVFHINHGNPFNLKALVDKWPDFNTVVIRP
HEQEMTDDLDHYTNTYQVYSRDPQNAQEFLASPEVINWKQHFQIQSNYNHSSVDVGYHFC
ISSPLIIKNSQNFLYLASQTAKKLAPSLLDTKNLSPSGGKPKAINEDMFRLSPLNVTHAA
FLNTFWAFGGNERSQRFIERCIQTFPSFCLLGPDGKLASWCLMDQTGETRVAGTLPEYRS
QGLVSYVVYTLGQTMDKLGFPVYSHTDKSNKAMQKMSYTLHHIPMSCDWNQWHCTPL
Download sequence
Identical sequences ENSCPOP00000008393 ENSCPOP00000008393 10141.ENSCPOP00000008393

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]