SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000008504 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000008504
Domain Number 1 Region: 1015-1354
Classification Level Classification E-value
Superfamily NHL repeat 5.75e-23
Family NHL repeat 0.0021
Further Details:      
 
Domain Number 2 Region: 1254-1504
Classification Level Classification E-value
Superfamily NHL repeat 0.0000000000863
Family NHL repeat 0.018
Further Details:      
 
Domain Number 3 Region: 710-785
Classification Level Classification E-value
Superfamily Carboxypeptidase regulatory domain-like 0.000000314
Family Pre-dockerin domain 0.073
Further Details:      
 
Weak hits

Sequence:  ENSCPOP00000008504
Domain Number - Region: 516-540
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000385
Family Integrin beta EGF-like domains 0.051
Further Details:      
 
Domain Number - Region: 450-474
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000427
Family EGF-type module 0.05
Further Details:      
 
Domain Number - Region: 585-620
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000435
Family EGF-type module 0.061
Further Details:      
 
Domain Number - Region: 382-409
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00159
Family Integrin beta EGF-like domains 0.029
Further Details:      
 
Domain Number - Region: 417-441
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00343
Family Integrin beta EGF-like domains 0.042
Further Details:      
 
Domain Number - Region: 352-376
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00645
Family EGF-type module 0.024
Further Details:      
 
Domain Number - Region: 546-571
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0209
Family EGF-type module 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000008504   Gene: ENSCPOG00000009475   Transcript: ENSCPOT00000009561
Sequence length 2551
Comment pep:novel scaffold:cavPor3:scaffold_36:11236707:11432053:-1 gene:ENSCPOG00000009475 transcript:ENSCPOT00000009561 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SEQPANNQGQSTLQPLPPSHKQHSTQHHPSITSLNRNSLTNRRNQSPAPPAALPAELQTT
PESVQLQDSWVLGSNVPLESRHFLFKTGTGTTPLFSTATPGYTMASGSVYSPPTRPLPRN
TLSRSAFKFKKSSKYCSWKCTALCAVGVSVLLAILLSYFIAMHLFGLNWQLQQTENDTFE
NGKVNSDTMPTNTVSLPSGDSGKLGGFTQENNTIDSGELDIGRRAIQEVPPGIFWRSQLF
IDQPQFLKFNISLQKDALIGVYGRKGLPPSHTQYDFVELLDGSRLIAREQRNLVEAERAG
RQARSISLHEAGFIQYLDSGIWHLAFYNDGKNAEQVSFNTIVIESVVECPRNCHGNGECV
SGTCHCFPGFLGPDCSRAACPVLCSGNGQYSKGRCLCFSGWKGTECDVPTTQCIDPQCGG
RGICIMGSCACNSGYKGENCEEADCLDPGCSNHGVCIHGECHCNPGWGGSNCEILKTMCP
DQCSGHGTYLQESGSCTCDPNWTGPDCSNEICSVDCGSHGVCMGGTCRCEEGWTGPACNQ
RACHPRCAEHGTCKDGKCECSQGCNGEHCTIVSQAHYLDKIVKEGCPGLCNSNGRCTLDQ
NGWHCVCQPGWRGAGCDVAMETLCTDSKDNEGDGLIDCMDPDCCLQSSCQNQPYCRGLPD
PQDIISQSLQSPSQQAAKSFYDRISFLIGSESTHVLPGESPFNKSLASVIRGQVLTADGT
PLIGVNVSFFHYPEYGYTITRQDGMFDLVANGGASLTLVFERSPFLTQYHTVWIPWNVFY
VMDTLVMKKEENDIPSCDLSGFVRPNPIIVSSPLSTFFRSSPEDSPIIPETQVLHEETTI
PGTDLKLSYLSSRAAGYKSVLKITMTQSVIPFNLMKVHLMVAVVGRLFQKWFPASPNLAY
TFIWDKTDAYNQKVYGLSEAVVSVGYEYESCLDLTLWEKRTAVLQGYELDASNMGGWTLD
KHHVLDVQNGILYKGNGENQFISQQPPIVSSIMGNGRRRSISCPSCNGQADGNKLLAPVA
LACGIDGSLYVGDFNYVRRIFPSGNVTSVLELRNKDFRHSSNPAHRYYLATDPVTGDLYV
SDTNTRRIYRPKSLTGAKDLTKNAEVVAGTGEQCLPFDEARCGDGGKAVEATLMSPKDKG
MAVDKNGLIYFVDGTMIRKVDQNGIISTLLGSNDLTSARPLTCDTSMHISQVRLEWPTDL
AINPMDNSIYVLDNNVVLQITENRQVRIAAGRPMHCQVPGVEYPVGKHAVQTTLESATAI
AVSYSGVLYITETDEKKINRIRQVTTDGEISLVAGIPSECDCKNDANCDCYQSGDGYAKD
AKLNAPSSLAASPDGTLYIADLGNIRIRAVSKNKPLLNSMNFYEVASPTDQELYIFDING
THQYTVSLVTGDYLYNFSYSNDNDITAVTDSNGNTLRIRRDPNRMPVRVVSPDNQVIWLT
IGTNGCLKSMTAQGLELVLFTYHGNSGLLATKSDETGWTTFFDYDSEGRLTNVTFPTGVV
TSLHGDMDRAITVDIESSSREEDVSITSNLSSIDSFYTMVQDQLRNSYQIGYDGSLRIIS
ASGLDSHYQTEPHVLAGTANPTVAKRNMTLPGENGQNLVEWRFRKEQAQGKVNVFGRKLR
VNGRNLLSVDFDRTTKTEKIYDDHRKFLLRIAYDTSGHPTLWLPSSKLMAVNVTYSSTGQ
IASIQRGTTSEKVDYDGQGRIVSRVFADGKTWSYTYLEKSMVLLLHSQRQYIFEYDMWDR
LSAITMPSVARHTMQTIRSIGYYRNIYNPPESNASIITDYNEEGLLLQTAFLGTSRRVLF
KYRRQTRLSEILYDSTRVSFTYDETAGVLKTVNLQSDGFICTIRYRQIGPLIDRQIFRFS
EDGMVNARFDYSYDNSFRVTSMQGVINETPLPIDLYQFDDISGKVEQFGKFGVIYYDINQ
IISTAVMTYTKHFDAHGRIKEIQYEIFRSLMYWITIQYDNMGRVTKREIKIGPFANTTKY
AYEYDVDGQLQTVYLNEKIMWRYNYDLNGNLHLLNPSNSARLTPLRYDLRDRITRLGDVQ
YRLDEDGFLRQRGTEIFEYSSKGLLTRVYSKGSGWTVIYRYDGLGRRVSSKTSLGQHLQF
FYADLTYPTRITHVYNHSSSEITSLYYDLQGHLFAMEISSGDEFYIASDNTGTPLAVFSS
NGLMLKQIQYTAYGEIYFDSNIDFQLVIGFHGGLYDPLTKLIHFGERDYDILAGRWTTPD
IEIWKRIGKDPAPFNLYMFRNNNPASKIHDVKDYITDVNSWLVTFGFHLHNAIPGFPVPK
FDLTEPSYELVKSQQWDDVPPIFGVQQQVARQAKAFLSLGKMAEVQVSRRKTGGEQSWLW
FATVKSLIGKGVMLAVSQGRVQTNVLNIANEDCIKVAAVLNNAFYLENLHFTIEGKDTHY
FIKTTTPESDLGTLRLTSGRKALENGINVTVSQSTTVVNGRTRRFADVEMQFGALALHVR
YGMTLDEEKARILEQARQRALARAWAREQQRVRDGEEGARLWTEGEKRQLLSAGKVQGYD
GYYVLSVEQYPELADSANNIQFLRQSEIGKR
Download sequence
Identical sequences ENSCPOP00000008504 10141.ENSCPOP00000008504 ENSCPOP00000008504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]