SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000008522 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000008522
Domain Number 1 Region: 34-179
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 2.96e-23
Family N-acetyl transferase, NAT 0.00097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000008522   Gene: ENSCPOG00000009495   Transcript: ENSCPOT00000009581
Sequence length 183
Comment pep:known_by_projection scaffold:cavPor3:scaffold_23:18331263:18336685:-1 gene:ENSCPOG00000009495 transcript:ENSCPOT00000009581 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKPDETPMFDPSLLREVDWSQNTATFSPAISPAHPGEGLVLRPLCTADLNRGFFKVLGQL
TETGVVSPEQFMKSFEHMKKSGDYYVLVVEDVTLGQIVATATLIIEHKFIHSCAKRGRVE
DVVVSDECRGKQLGKLLLSTLTLLSKKLNCYKITLECLPQNVGFYKKFGYTVSEENYMCR
RFL
Download sequence
Identical sequences ENSCPOP00000008522 10141.ENSCPOP00000008522 ENSCPOP00000008522

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]