SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000008540 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000008540
Domain Number 1 Region: 522-554,656-731
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.000000000000437
Family Anti-sigma factor antagonist SpoIIaa 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000008540   Gene: ENSCPOG00000009513   Transcript: ENSCPOT00000009599
Sequence length 789
Comment pep:known_by_projection scaffold:cavPor3:scaffold_12:16917807:16935042:1 gene:ENSCPOG00000009513 transcript:ENSCPOT00000009599 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSQPRPRFVVDRAAYSLTLFDEEFEKKDRTYPLGAKLRHAFRCSSTKIKTVAFGLLPILS
WLPKYKIKEYLLPDVLGGLSGGCIQVPQGMAFALLANLPAVNGLYSSFFPLLTYFFLGSV
HQMVPGTFAVISILVGNICLQLAPESKFRVFNNVTNESYIDTAAMDTERLHVSATLACLT
AIIQMGLGFMQFGFVAIYLSESFVRGFMTAAGLQILISVLKYIFGLTVPPYSGPGSIVLT
FIDICKNLPHTNIASLIFALISALILVVVKELNARYMHKIRFPIPTEVVVVVVATAISGS
YKMPQKYHMQIVGHIQHGFPTPVSPVVSQWKDMIGTAFSLAIVGYVINLAMGRTLADKHG
YSVDSNQEMIALGCSNFFGSFFKIHVICCALSVTLAVDAAGGRSQVASLCVSLVVMITML
VLGSYLYPLPKAVLGALIAVNLKNSLKQLTDPYYLWRKSKLDCCVWVVSFLSSFFLSLPY
GVAVGVAFSVLVVVFQTQFRNGYVLARVMDTDIYVNPKTYSRVQEIEGIKIITYCAPLYF
ANSEIFKQKVIAKTGTDPQKVLLAKQKHLRRQEKRMAPTQQRKSLFMKTKTVSLQELQQD
FENVTPTDPNNNQTLANGAGISYVTFSPDTSASPCEPVTSAEPPREPSDILASVPPFVTF
HTLVLDMSGVSFVDLMGTKALAKLSSTFGKIGVKVFLVNIHAQVYNDISHGGVFEDGCVQ
RKHVFPSIHDAVLFAQENAREAVPGQNSQRAPEDTELSLCDSEEDNPGYWDLEQEMFGSM
FHTETLTAL
Download sequence
Identical sequences H0VET1
ENSCPOP00000008540 ENSCPOP00000008540 XP_003474831.1.53824 XP_013013570.1.53824 10141.ENSCPOP00000008540

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]