SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000008682 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000008682
Domain Number 1 Region: 40-284
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 9.44e-89
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.000000349
Further Details:      
 
Domain Number 2 Region: 285-483
Classification Level Classification E-value
Superfamily Putative anticodon-binding domain of alanyl-tRNA synthetase (AlaRS) 1.57e-46
Family Putative anticodon-binding domain of alanyl-tRNA synthetase (AlaRS) 0.00013
Further Details:      
 
Domain Number 3 Region: 619-796
Classification Level Classification E-value
Superfamily ThrRS/AlaRS common domain 2.88e-31
Family AlaX-like 0.018
Further Details:      
 
Domain Number 4 Region: 546-618
Classification Level Classification E-value
Superfamily Translation proteins 0.0000000000918
Family AlaX-M N-terminal domain-like 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000008682   Gene: ENSCPOG00000009676   Transcript: ENSCPOT00000009763
Sequence length 985
Comment pep:known_by_projection scaffold:cavPor3:scaffold_15:30570606:30579556:1 gene:ENSCPOG00000009676 transcript:ENSCPOT00000009763 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAASMAGVAGRLRRAIRRSPSWAGRSRRPLSTQPPPTQGSAVRDAFLSFFRDRHGHRLVP
SASVRPRGDPSLLFVNAGMNQFKPIFLGTVDPRSEMAGFRRVANSQKCVRAGGRHNDLED
VGRDLSHHTFFEMLGNWAFGGEYFKEEACSMAWELLTQIYGIPKDRLWVSYFGGDPKAGL
DPDLETRDIWLSLGVPVNRVLSFGPQENFWEMGDTGPCGPCTEIHYDLAGGVGAPQLVEL
WNLVFMQYNREANGSLQSLPQRHVDTGMGLERLVAMLQGKHSTYDTDLFSPLLHAIHQGC
GAPPYLGRVGAADEGHTDTAYRVVADHIRTLSICIADGVFPGMSGAPLVLRRILRRAVRF
STEVLQAPPGFLGSLVPVVVETLGDTYPELRRNSAQIASLVSEEEAAFLDSLQRGRRIIE
RTLKRLGPSDLFPADVAWSLSMSGNLGLPLDLVELMLAEKGVHLDSERLAQLVEEEAQLR
GRQAEPAQEQRLRLDVHALAELQHRGVSPTDDSPKYSYSLQSTGNYEFGPCEAQVLQLYT
EDGAAVASVGPGQRCGLLLNRTNFYAEQGGQASDRGYLVRIEQQDVLFPVTQAQVWGGFV
LHEVLASEHLQGDLVQLHVDEDWRLSCMEKHTATHLLNWALRETLGPNVEQRGSHLNPER
LRFDVATQTLPASKGQLRTIEDTVQEAVQQDKPVYMEEVPLELTACIPGLRSLDEVYPDP
VRVVSVGVPVACALDPMSQAALQASVELCCGTHLLRTGAVGDLVITGERQLTKGTTRLLA
VTGEQAQQAREVGESLAREVDAAAERLSQGTRNLAEAQQLSKDIGRLTEAVDNAMMPQWQ
RRALQARLKLLQRRANTTIRKLELGQAAVKSQELLRRHEKGPLIVDTVSAESLSMLVKVV
RQLCELAPGTSVLLLSPQPVGSVLCACQVAQGATPAFSAEAWALAVCRHMGGRAWGSNVV
AQGTGSTADLDAALSAARAYALNQL
Download sequence
Identical sequences 10141.ENSCPOP00000008682 ENSCPOP00000008682 ENSCPOP00000008682

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]