SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000008974 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000008974
Domain Number 1 Region: 235-356
Classification Level Classification E-value
Superfamily TIMP-like 6.12e-33
Family Netrin-like domain (NTR/C345C module) 0.00029
Further Details:      
 
Domain Number 2 Region: 92-194
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.02e-24
Family Spermadhesin, CUB domain 0.00039
Further Details:      
 
Domain Number 3 Region: 1-81
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 6.15e-21
Family Spermadhesin, CUB domain 0.00076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000008974   Gene: ENSCPOG00000009999   Transcript: ENSCPOT00000010089
Sequence length 356
Comment pep:known_by_projection scaffold:cavPor3:scaffold_8:39542302:39561173:-1 gene:ENSCPOG00000009999 transcript:ENSCPOT00000010089 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LQVPEGKVVVLNFRFIDLESDNLCRYDFVDVYNGHTNGQRIGRFCGTFRPGALVSSGNKM
MVKMISDANTAGNGFMAMFSASEPNERGDQYCGGRLERPSGSFKTPNWPDRDYPVGVTCI
WHIIAPKNQLIELKFEKFDVERDNYCRYDFVAVFNGGEVNDAQRIGKYCGDSPPAKLLSC
VTVILLGFNRDLSAHFVQLKGAQLYRPPSLPTSLKKQVTAKFGLSLISGLKPTVALCQQK
CRRTGTLESNYCSNNFVLVGAVITTTPRGESLQATISIINIYKEGNLAIQQAGKNMSAKV
TVVCRQCPLLRRVGLNYIIMGQAGEDGQGKIMPNSFVMMFKTKNQKLLNALKNKQC
Download sequence
Identical sequences 10141.ENSCPOP00000008974 ENSCPOP00000008974 ENSCPOP00000008974

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]