SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000008998 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000008998
Domain Number 1 Region: 461-675
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.17e-31
Family Laminin G-like module 0.0093
Further Details:      
 
Domain Number 2 Region: 687-888
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 9.63e-27
Family Laminin G-like module 0.02
Further Details:      
 
Domain Number 3 Region: 910-1111
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.34e-25
Family Laminin G-like module 0.0076
Further Details:      
 
Domain Number 4 Region: 147-189
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000109
Family EGF-type module 0.0034
Further Details:      
 
Domain Number 5 Region: 224-265
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000221
Family EGF-type module 0.0066
Further Details:      
 
Domain Number 6 Region: 1296-1335
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000393
Family EGF-type module 0.0042
Further Details:      
 
Domain Number 7 Region: 1139-1180
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000005
Family EGF-type module 0.0074
Further Details:      
 
Domain Number 8 Region: 303-342
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000071
Family EGF-type module 0.0099
Further Details:      
 
Domain Number 9 Region: 185-227
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000391
Family EGF-type module 0.0037
Further Details:      
 
Domain Number 10 Region: 261-299
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000172
Family EGF-type module 0.0046
Further Details:      
 
Domain Number 11 Region: 1213-1251
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000031
Family EGF-type module 0.02
Further Details:      
 
Domain Number 12 Region: 111-152
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000034
Family EGF-type module 0.018
Further Details:      
 
Domain Number 13 Region: 71-113
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000382
Family EGF-type module 0.013
Further Details:      
 
Domain Number 14 Region: 1172-1217
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000586
Family EGF-type module 0.013
Further Details:      
 
Domain Number 15 Region: 377-481
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000612
Family Growth factor receptor domain 0.012
Further Details:      
 
Domain Number 16 Region: 1264-1301
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000132
Family EGF-type module 0.02
Further Details:      
 
Weak hits

Sequence:  ENSCPOP00000008998
Domain Number - Region: 25-57
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0045
Family EGF-type module 0.029
Further Details:      
 
Domain Number - Region: 338-356
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0102
Family EGF-type module 0.017
Further Details:      
 
Domain Number - Region: 884-915
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0233
Family EGF-type module 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000008998   Gene: ENSCPOG00000010025   Transcript: ENSCPOT00000010116
Sequence length 1405
Comment pep:known_by_projection scaffold:cavPor3:scaffold_12:24756899:24946552:-1 gene:ENSCPOG00000010025 transcript:ENSCPOT00000010116 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MELQKINSLLIYLSFSLLIYIQNSFCDKNTTRCLSNSCQNNSTCKSFSQDSKCHCSDTAN
NLDEDCDNMKDPCSSNPCQGIATCMNTPGERGFQCQCPPGYNGVTCETALGSCGMGSCQH
GGTCLQDPVHPVCICPAGYGGRFCEIDHDECASSPCHNGAVCQDAINGYFCFCVPGYQGR
HCDLEVDECVSDPCKNEAICLNEIGRYTCICPQDYSGVNCELQVDKCWSQPCLNGATCRD
ALEAYFCDCAPGFLGDHCELSIDECASQPCLHGGLCVDGRNRYSCNCVGSGFTGTHCETL
MPVCWSKPCHNNATCEDSVDNYICHCWPGYSGAQCETDINECSSNPCQSGGECVERSLEK
QYGRIAQLPPPFSYHEAAGYVCVCQPGFTGIHCEEDINECLSHPCKNGGTCENLPGNYSC
HCPFDNLSRTFYGGQDCSDILLGCTHRQCLNNGICIPHFHNGHHGFSCLCPSGFTGSLCE
AVTTLSFGGNSFLWVTSGSHTTKSSVCNIIFRFQTVQPMALLFIWGSRDMFAKLELLHGY
IHLSVRVHNQLRVLLYISHNTSDGLWHLVEVIFSETVTLSLTDDSCKEKCVTDAPSPFEI
NQSICAFRDSFLGGLPVEMTRDGIALLDIYNTASTPSFVGCLQDIKFDSNPITLENISSG
LSLNIKAGCMRKDWCKSQPCQNRGRCINLWLGYQCDCYRPYAGPNCVREYVAGRFGLDGS
AAYAVFKVDENYGRNFSLSMFVRTHRPSGFLLALENSTYHYIRVWLEHGRLALLTPGSPK
LLAKFVLSDGNFHLISLKIKSNRIELFQSSQKLGFISAPTWKIQKGDVIYIGGLPDRQET
EINSGFFKGCIQDIRLNNQNLEFFPNSTNSSSHHPVLVNVVQGCPGDNVCKSNPCFNGGV
CYALWDDFSCACPANTAGKACEEVRWCELSPCPASTRCQPVPRGFECIGNVVLSGQSSNI
LFQSNGNITRELTNITFGFRTRDANVIILHAENEPAFLNISIQDSRLSFQLQSGNNFYIL
QLRSLQSVNDGTWHQVTLSMTDPLAPISRWQMKLDNQTSFVTSAIATGSLNFLKDNTDIY
VGDSFIDNMKGFQGCLSTIEIGGIYLSYFENVHGVTNKPQEEQFLKISTNLVLTGCLQLN
ACLSNPCLHGGDCEDLYSSYHCSCPSGWSGSHCELNIDECFSNPCIHGNCSDRVAAYQCR
CEPGYTGVNCEAEIDNCQSHQCANGATCISDTNGYSCLCFGNFTGKFCRHSRLPSTVCGN
GITNLTCYNGGNCTEFHAELKCMCRAGFTGERCEQDIDECASAPCLNGGLCQDLLGRFQC
LCDVAFAGDRCELDLAGDMTSDLLTAIGSVTSVLLLILLLAVIASIAASNKRATQGTYNP
SLQEKEGARVEMWSVTPPPTMERLI
Download sequence
Identical sequences ENSCPOP00000008998 10141.ENSCPOP00000008998 ENSCPOP00000008998

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]