SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000009056 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000009056
Domain Number 1 Region: 110-310
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 3.04e-46
Family Reprolysin-like 0.00026
Further Details:      
 
Domain Number 2 Region: 325-401
Classification Level Classification E-value
Superfamily Blood coagulation inhibitor (disintegrin) 1.82e-18
Family Blood coagulation inhibitor (disintegrin) 0.0004
Further Details:      
 
Weak hits

Sequence:  ENSCPOP00000009056
Domain Number - Region: 549-588
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0347
Family Integrin beta EGF-like domains 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000009056   Gene: ENSCPOG00000010085   Transcript: ENSCPOT00000010176
Sequence length 780
Comment pep:known_by_projection scaffold:cavPor3:scaffold_11:19798991:19879538:1 gene:ENSCPOG00000010085 transcript:ENSCPOT00000010176 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LQGGEHCYYQGHIRGNPASFVALSTCHGLHGMFYDGNHTYLIEPEENETSPEDFRSHLVY
KSRVFEFPLDDLPSEFQQVNITLPKFIPKPRLRRSKRQLLRYPRNVEEETKYIELMIVND
HLMFKKHRLSVVHTNTYAKSVVNMADLIYKDQLKTRIVLVAMETWAADNKFAISENPLIT
LREFMKYRRDFIKEKSDAVHLFSGSQFESSRSGAAYIGGICSLLKGGGVNEFGKTDLMAV
TLAQSLAHNIGIISDKRKLASGECKCDDTWSGCIMGDTGYYLPKKFTQCNIEEYHDFLNS
GGGTCLFNKPSKLLDPPECGNGFIETGEECDCGTSAECVLEGAECCKKCTLTQDSQCSDG
LCCQKCKFQPMGTVCREAVNDCDIRETCSGNSSQCAPNVHKMDGYQCDGVQGICFGGRCK
TRDRQCKYIWGQKVTASDKYCYEKLNIEGTEKGNCGKDKDTWIQCNKRDVLCGYLLCTNI
GNIPRLGELDGEITSTLVVQQGRTLNCSGGHVKLEEDVDLGYVEDGTPCGPKMMCLEHRC
LPVASFNFSTCLSNKEGIVCSGNGFCSNELTCVCNRHWTGADCSIYFPYNEDAKTGITLS
GNGVAGTNIIIGIIAGTILVLALILGITAWGYKKRNYREQRQLPQGDYVKKPGDGDSFYS
DIPPGVSTNSASSSKKRSNGLSHSWSERIPDTKHISDICENGRPRSNSWQGNLGGNRKKI
RGKRFRPRSNSTETLSPAKSPSSSTGSIASSRKYPYPMPPLPDEEKAVNRHSARLWETSI
Download sequence
Identical sequences 10141.ENSCPOP00000009056 ENSCPOP00000009056 ENSCPOP00000009056

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]