SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000009235 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000009235
Domain Number 1 Region: 83-288
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 1.44e-44
Family Reprolysin-like 0.0055
Further Details:      
 
Domain Number 2 Region: 386-442
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000000144
Family TSP-1 type 1 repeat 0.00046
Further Details:      
 
Domain Number 3 Region: 1073-1137
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000602
Family TSP-1 type 1 repeat 0.0029
Further Details:      
 
Domain Number 4 Region: 1297-1406
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.0000000673
Family Spermadhesin, CUB domain 0.015
Further Details:      
 
Domain Number 5 Region: 1026-1079
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000889
Family TSP-1 type 1 repeat 0.0094
Further Details:      
 
Domain Number 6 Region: 1191-1276
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.0000112
Family Spermadhesin, CUB domain 0.0098
Further Details:      
 
Weak hits

Sequence:  ENSCPOP00000009235
Domain Number - Region: 738-773
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000129
Family TSP-1 type 1 repeat 0.007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000009235   Gene: ENSCPOG00000010285   Transcript: ENSCPOT00000010379
Sequence length 1413
Comment pep:known_by_projection scaffold:cavPor3:scaffold_18:39313563:39336831:1 gene:ENSCPOG00000010285 transcript:ENSCPOT00000010379 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VLRMSPWARGTLLQAASAGGILTGAFLILGCWGLSDFQQTCVQALEPEEVSSYFGADAAF
EGAPAPGLWRPTRRRRRAAGGVLHLELLVAVGPDVHQAHQEDTERYVLTNLHIGSDLLRD
PSLGVQVQVYLVKLLILTEPEDAPNITANITSSLRSVCEWSRSVNPADDRDPGHADLVLY
ITRFDLELPDGNRQVRGVTQLGGACSPSWSCLITEDTGFDLGVTIAHEVGHSLGLDHDGE
PGSGCRSSGHVMAPDGLATTLRGRVWSPCSHRQLQQLLSTGWMRCMWDPPRLPGGPVRRL
PDAQPGLYYGMDEQCRIAFGQAAVACTFAREGVDMCQALSCHTDPLDQSSCSRRLVALLD
GTECGVEKWCFKGRCHSLVELKPMAAVHGCWSSWGPSSPCSRSCGGGVVTRRRRCDNPRP
AFGGRACAGADLQAEMCNTQACEKTQLEFMSEQCAQTDRQPLSLSLGGTSFYHWGAAVQY
SQGDALCRHVCWAVGESFIVRRGDRFLDGTRCVPSSPQEDGTLSLCVLGSCRMFGCDGRM
DSQQVWDVCQVCGGDNSTCSLQNGSFTGGAAREYVTFLTVTPNMTSVHIVNRRPLFTHLA
VKIGGRYVVAGEAGLAPSTTHPSLLEDSRVEYRVALTEDQLPRQEEIRIWGAVREDVEVQ
VYRRYGEEYGALTHPDITFTYFQPKQQAAWAWAEERGPCSVSWLRWVSYGCLDQAQNVWV
EASWCQGSPRPPAWPEACVSVPCPLRSAGDFGPCSASCGGGLQSSAVLHRGPAQPSEDAA
LARGGLAAHLGDLQQPATTSPSWCRCPPSPLAQEVSEPDLCTAATCGPGPASLNVTCVQV
AGGPGSPATPGPCTTHEMPSTSETCVGTTCPLAWAQISSSQPIPQRTLPLPRGLQRPRAP
AVPMWTPVPGLCSVSCGQGLVELRSLCVDPVLRTPVQEKLCNLASRPGSRWEVCWAGPCP
AHWEAWALAPCPVTCGEGRVLLAVCYMRLESSHPVPLPHSKCWPAPRPSPFQDCSPEPCP
AKWKVLSLGPCSASCGLGTAMRVVACVQLDQGRDTEVDEAACVALVRPQASVPCFVADCT
YQWHVSPWTECSASCGEGIQRRHDTCLGPQGQAPLPASFCQHLPKPATVQGCWAGPCVGQ
GAPSLVPHGDTTTLGPTTATTALAQLMTPAQARPTPPAAQLPGPQGSTAETSACGRQYLE
PIGTINMRGSGQADCLVAIGRPLGEVVILQVLESSLNCSAGELLLLWGRLTWRKVCRNLA
GRTFGSKTNTLVVRQHRLWPEGGVVLRYESQPAHEVFHRECDTQLFGPQGDIVSPLPSPD
ERTAGTCRVFINVAPQARIAIHILATSMGTGTNGSSVSIRDVHSPRATTFRGQQALYWES
EGSEAELEFSKDFLEGHAGLRGRYWTLPSRLLE
Download sequence
Identical sequences ENSCPOP00000009235 10141.ENSCPOP00000009235 ENSCPOP00000009235

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]