SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000009506 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000009506
Domain Number 1 Region: 308-606
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 5.94e-82
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.000000194
Further Details:      
 
Domain Number 2 Region: 129-306
Classification Level Classification E-value
Superfamily ThrRS/AlaRS common domain 7.59e-40
Family Threonyl-tRNA synthetase (ThrRS), second 'additional' domain 0.00044
Further Details:      
 
Domain Number 3 Region: 608-714
Classification Level Classification E-value
Superfamily Class II aaRS ABD-related 1.96e-25
Family Anticodon-binding domain of Class II aaRS 0.0012
Further Details:      
 
Domain Number 4 Region: 68-129
Classification Level Classification E-value
Superfamily TGS-like 0.000000000327
Family TGS domain 0.0058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000009506   Gene: ENSCPOG00000010586   Transcript: ENSCPOT00000010681
Sequence length 725
Comment pep:known_by_projection scaffold:cavPor3:scaffold_2:11516977:11531373:1 gene:ENSCPOG00000010586 transcript:ENSCPOT00000010681 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRLFQRWRSLRLRSLLPGLQAYKLHTLRETSVATPPQWLVERLGLFEELWAAQATRLAST
AQNEARTIKVTLPGGQKVNGVAWSTTPYQLARQMSLTLADTALAAEVNGEPFDLERPLET
DSDLRFLTFDSPEGKAVFWNSSAHILGAAAEQFLGAVLCRGLSIEHGFYHDFFLGKERTV
QGSEIPILEQICQRIAADAQPFRRLVASQDQLRQLFKDNPFKLRLIEEKVTNPTATVYGC
STSIDLCQGPHLRHAGQIGVLKLLTSSSALWRSSSSLEALQRVSGISFPTEELLRAWEAQ
REEAGSRDHRRIGKDQELFFFHEFSPGSCFFLPRGTRVYNALVAFIRAQYARHGFSEVKT
PTLFSAKLWEQSGHWEHYREDIFTLQPKGSSRPISSQSDHFARPPTETLALKPMNCPAHC
LMFAHRPRSWRELPVRLADFGALHRAEASGSLGGLTRLWRFQQDDAHIFCAPNQLQGEIR
GCLDFLHSVYAVLGFSFHLSLSTRPSGFLGESHLWDHAEQVLQQALEESGKPWDLKPGDG
AFYGPKIDAYLQDALGRPHQCGTIQLDFQLPLRFNLQYKGQAGALERPVLIHRAVLGSVE
RLLGVLAESCGGKWPLWLSPFQVVVIPVGTEQEEYAREIHQSLQASGLASDLDTDWGLTL
SRKVRRAQLAHYNFQFVIGQKEQNKRTVNIRTRDNRQLGERDLTAAVQRLLELQNARVSN
AEEVF
Download sequence
Identical sequences 10141.ENSCPOP00000009506 ENSCPOP00000009506 ENSCPOP00000009506 XP_003478967.1.53824

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]