SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000009531 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000009531
Domain Number 1 Region: 291-389
Classification Level Classification E-value
Superfamily Integrin alpha N-terminal domain 0.0000288
Family Integrin alpha N-terminal domain 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000009531   Gene: ENSCPOG00000010615   Transcript: ENSCPOT00000010712
Sequence length 436
Comment pep:known_by_projection scaffold:cavPor3:scaffold_80:7287387:7295280:-1 gene:ENSCPOG00000010615 transcript:ENSCPOT00000010712 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AMGEAAVAAGPCPLREDSFTRFSSQSNVYGLAGGADGRGELLAATLKGKVLGFRYQDLRQ
KIRLVAKELQFNYIPVDAEIVSIDTFNKSPPKRGLVVGITFIKDSGDKGSPFLNIYCDYE
PGSEYNLDSIAQSCLNLELQFTPFQLCHAEVQAGDRLETVFLLSGNDLAIHLYKENEGLH
QFEEQPVENLFPELTNLSSSVLWLDVCNLPGSSHRLSALGCQNGYIRVAHVDQQSREVLQ
TWTVLQDGPISRVILFKLAAPEQAEDRPQQEEYSVLVASMVEPAVVYRDLLNQGLENQLL
LPGSDQFDSILCGLVTDVDLDGQPEVLVATYGQELLCYKYCSLEPGRPEAEHGFRLLWQR
SFSSPLLAMAHVDLTGDGLQELAVVSLKGVHILQHSLIQASELVLTRLQRQVERKKRQPQ
GPGDRAGPGPAETTAS
Download sequence
Identical sequences ENSCPOP00000009531 10141.ENSCPOP00000009531 ENSCPOP00000009531

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]