SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000009539 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000009539
Domain Number 1 Region: 437-617
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.45e-36
Family Laminin G-like module 0.0029
Further Details:      
 
Domain Number 2 Region: 54-158
Classification Level Classification E-value
Superfamily Cadherin-like 7.99e-21
Family Cadherin 0.0012
Further Details:      
 
Domain Number 3 Region: 2-61
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000000271
Family Cadherin 0.0043
Further Details:      
 
Domain Number 4 Region: 163-252
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000742
Family Cadherin 0.0046
Further Details:      
 
Domain Number 5 Region: 748-788
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000021
Family EGF-type module 0.0065
Further Details:      
 
Domain Number 6 Region: 713-756
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000142
Family EGF-type module 0.016
Further Details:      
 
Domain Number 7 Region: 678-717
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000407
Family EGF-type module 0.015
Further Details:      
 
Weak hits

Sequence:  ENSCPOP00000009539
Domain Number - Region: 407-446
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0401
Family Laminin-type module 0.085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000009539   Gene: ENSCPOG00000010626   Transcript: ENSCPOT00000010723
Sequence length 1181
Comment pep:novel scaffold:cavPor3:scaffold_40:1906334:1958145:-1 gene:ENSCPOG00000010626 transcript:ENSCPOT00000010723 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DNEFAVDPVLGLVKVKKKLDRERVSGYSLLVQAVDGGIPAMSSTATVNIDISDVNDNSPV
FTPANYTAVIQENKPVGTSILQLVVTDRDSFHNGPPFSFSILSGNEEEEFVLDSHGILRS
AVVFQHTDSPEYVLCVQAKDSGKPQQVSHSYIRVRVIEESIHKPTAIPLEIFIVTMEDDF
PGGVIGKIHATDQDMYDVLTFALKSEQKSLFKVNSHDGKIIALGGLDSGKYVLNVSVSDG
RFQVPIDVVVHVEQLVHEMLQNTVTIRFENVSPEDFVGLHMHGFRRTLRNAVLTQKQDSL
HIISIQPVAGTNQLDMLFAVEMHSSEFYKPAYLIQKLSSARRHLENVIRIAAILEKNCSG
LDCQEQHCEQGLSLDSHALMTYSTARISFVCPRFYRNVRCTCNGGLCPGSNDPCVEKPCP
GDMQCVGYEASRRPFLCQCPPGKLGECSGHTSLSFAGNSYIKYRLSENSKEENFKLALRL
RTLQSNGIIMYTRANPCIILKIVDGKLWFQLDCGSGPGILGISGRMVNDGSWHSVFLELN
RNFTSLSLDDSYVERRRAPLYFQTLSTESSIYFGALVQADNIRSLTDTRVTQVLSGFQGC
LDSVVLNNNELPLQNKRSSFAEVVGLTELKLGCVLYPDACERSPCQHGGSCSGLPSGEYF
LKIIFLYYKTYCSRVVVTCYHNPTIMEGNRQKDSNGYQCTCLSQFTGRNCESEITACFPN
PCRNGGSCDPIGNTFICSCKAGLTGVTCEEDVNECEREECENGGACVNVFGSFLCNCTPG
YVGQYCGLRPVVVPNIQAGHSYVGKEELVQDPATAALLHKSNGIPFRNLCGGDGRNVYQE
VGPPQVPVRPMAYTPCFQSDSRSNLDKLVDGLGGEHQEMTTFHPESPRILTARRGVVVCS
VAPNLPAVSPCRSDCDSIRKNGWDAGTETTTVVQVPNLGRKEQEEMAKKSFDNKGSASEV
QSLSSFQSDSGDDNAYHWDTSDWMPGARLSDIEEVPNYENQDGGSAHQGSTRELESDYYL
GGYDIDNEYPPPHEEEFLSQDQLPPPLPEDFPDQYEALPPSQPVSLASTLSPDCRRRPQF
HPSQYLPPHPFPIETDLVGPPAGCEFSTFAVSMNQSTEATGPADSVSLSLHNSRGTSSSD
VSATCGFEDSEVAVSDYESVAELSLASLHIPFVETQHQTQV
Download sequence
Identical sequences 10141.ENSCPOP00000009539 ENSCPOP00000009539 ENSCPOP00000009539

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]