SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000009549 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000009549
Domain Number 1 Region: 3943-4314
Classification Level Classification E-value
Superfamily RCC1/BLIP-II 1.13e-101
Family Regulator of chromosome condensation RCC1 0.0012
Further Details:      
 
Domain Number 2 Region: 423-779
Classification Level Classification E-value
Superfamily RCC1/BLIP-II 3.23e-87
Family Regulator of chromosome condensation RCC1 0.0078
Further Details:      
 
Domain Number 3 Region: 4451-4784
Classification Level Classification E-value
Superfamily Hect, E3 ligase catalytic domain 1.44e-84
Family Hect, E3 ligase catalytic domain 0.0000457
Further Details:      
 
Domain Number 4 Region: 2960-3235
Classification Level Classification E-value
Superfamily RCC1/BLIP-II 4.19e-73
Family Regulator of chromosome condensation RCC1 0.0025
Further Details:      
 
Domain Number 5 Region: 2735-2917
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 3.66e-32
Family APC10-like 0.0064
Further Details:      
 
Domain Number 6 Region: 2560-2637
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 1.23e-29
Family CPH domain 0.00065
Further Details:      
 
Domain Number 7 Region: 1869-1935
Classification Level Classification E-value
Superfamily Mib/herc2 domain-like 2.62e-21
Family Mib/herc2 domain 0.00013
Further Details:      
 
Domain Number 8 Region: 1207-1291
Classification Level Classification E-value
Superfamily Cytochrome b5-like heme/steroid binding domain 0.0000000000000432
Family Cytochrome b5 0.0087
Further Details:      
 
Weak hits

Sequence:  ENSCPOP00000009549
Domain Number - Region: 2463-2512
Classification Level Classification E-value
Superfamily UBA-like 0.000668
Family UBA domain 0.008
Further Details:      
 
Domain Number - Region: 3611-3701
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.0202
Family Spermadhesin, CUB domain 0.0095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000009549   Gene: ENSCPOG00000010638   Transcript: ENSCPOT00000010735
Sequence length 4830
Comment pep:known_by_projection scaffold:cavPor3:scaffold_264:353075:533287:1 gene:ENSCPOG00000010638 transcript:ENSCPOT00000010735 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPSESFCLGAQARLDSKWLKTDIQLAFTRDGLCGLWNEMVKDGEIVYTGSELSQSGEFPP
RKDDGVDTQSGAKKEDLSDKEKKDDEEAPAPALRAKSILESWVWGRQPDVKELKECLSVL
VKEQQALAVQSATTALSALRLKQRLVILERYFIALSRSACQESVGVRWKSISVAQPPVDK
KSSRPTGRGVEGLARVGSRAALSFAFAFLRRAWRSGEDADLCSELLQESLDALRALPEAS
LFDESSVSSVWLEVVERATRFLRSVVTGDVHGTPGTKGPGGVPLQDQHLALAILLELAVQ
RGTLSQMLSAILLLLQLWDSGAQETDNERSAQGTSAPLLPLLQRFQSIICSKDMPQTEED
AHLLSGPLSPNESFLRYLTLPQDNELAIDLRQTAVVVMAHLDRLATPCMPPLCSSPTSHK
GSLQEVIGWGLIGWKYYANVIGPIQCEGLANLGVTQIACAEKRFLILSRNGRVYTQAYNS
DTLAPQLVQGLASRNIVKIAAHSDGHHYLALAATGEVYSWGCGDGGRLGHGDTLPLEEPK
VISAFSGKQGGKHVVHIACGSTYSAAITAEGELYTWGRGNYGRLGHGSSEDEAIPMLVAG
LKGLKVIDVACGSGDAQTLAVTENGQVWSWGDGDYGKLGRGGSDGCKTPKLIEKLQDLDV
IKVRCGSQFSIALTKDGQVYSWGKGDNQRLGHGTEEHVRYPKLLEGLQGKKVIDVAAGST
HCLALTEDSEVHSWGSNDQCQHFDTLRVTKPEPTALPGLDTKHIVGIACGPAQSFAWSSC
SEWSIGLRVPFVVDICSMTFEQLDLLLRQVSEGMDGTADWPPPQEKECMAVATLNLLRLQ
LHAAISHQVDPEFLGLGLGSVLLNSLKQTVVTLASSAGVLNTVQSAAQAVLQSGWSVLLP
TAEERARALSALLPCTVSGNEVNISPGRRFMIDLLVGSLMADGGLESALNAAISAEIQDI
EAKNEAQKEKEIDEQEANASTFHRSRTPLDKDLINTGIYESSGKQCLPLVHLIQQLLRNI
ASQTVARLKDVARRISSCLDFEHHSRERSASLDLLLRFQRLLISKLYPGESIGQTSDISS
PELMGVGSLLKKYTALLCTHIGDILPVAASVAAVSWRHFAEVACILEGDFTGVLLPELVV
SIVLLLSKNPGLMQEAGAVPLLGGLLEHLDRFNHLAPGKERDDHEELAWPGIMESFFTGQ
NCRNNEEVTLIRKADLENHNKDGGFWTVIDGKVYDIKDFQTQSLTGNSILAQFAGEDPVV
ALEAALQFEDTRESMHAFCVGQYLEPDQEVVTIPDLGSLSSPLIDTERNLGLLLGLHASY
LAVSTPLSPVEIECAKWLQLSIFSGGLQTSQIHYSYNEEKDEDHCSSPGGTPAGKSRLCP
HRRALGDHSQAFLQAIADNNIQDHSVKDFLCQIERYCRQCHLTTPITFPPEHPVEEVGRL
LLCCLLKHEDLGHVALSLVHAGTLGIEQVKHRTLPKTVVDVCRVVHQAKCSLIKTHQEQG
RSYKEVCAPVIERLRFLFNELRPAVCSDLSIMSKFKLLSSLPRWRRIAQKIIRERRRNRV
FSNLVPKKPESTDDEEKIGNEDSDLEEACILPHSPINVDKRPVTIKSPKDKWQPLLSTVT
GVHKYKWLKQNVQGLYPQSALHSTIAEFALKEEPVDVEKMRKCLLKQLERAEVRLEGIDT
ILKLAAKNFLLPSVQYAMFCGWQRLIPEGIDIGAPLTDCLKDIDLIPPFNRMLLEVTFGK
LYAWAVQNIRNVLMDANAKFKELGIQPVPLQTITNENSSGPSLGTIPQARFLLVMLSMLT
LQHGANNLDLLLNSGTLALTQTTLRLIGPSSDNVEEDMNASARGASATVLEETRKETAPV
QLPVSGPELAAMMKIGTRVMRGVDWKWGDQDGPPPGLGRVIGELGEDGWIRVQWDTGSTN
SYRMGKEGKYDLKLAELPTSVQPLAEDSDTEDDSEAEQIEKNIHPTAMMLTSTINLLQTL
CLSVGVHAEIMQSEATKTLCGLLRMLVESGTTDKTSSPSRLVCREQHRSWCTLGFVRSIA
LTPQVCGALSSPQWIALLMKVVEGHAPFTAASLQRQILAVHLLQAVLPSWDKTERARDMK
CLVEKLFGFLGSLLTTCSSDIPLLRESALRRRRARPQASLTATHSSTLAEEVVALLRTLH
SLSQWNGLINKYINSQLRSITHSSVGKLSEGAQLEDYFPDSENPEVGGLMAVLAVIGGID
GRLRLGGQVMHDEFGEGTVTRITPKGRITVQFSDMRMCRVCPLNQLKPLPAVAFSVTNLP
FTEPMLAVWAQLVNLAGSKLEKHKIKKSPKQAFAGQVDLDLLRSQQLKLYILKAGWALLS
HQDKLRQILSQPAVQETGTLHADDGAAASPELGDMSPEGPQPPMILLQQLLASATQPSPV
KAIFDKQELEAAALAVCQCLAVESTHPLSPGFEDCSSSEATTPISVQHTRPARVKRRKQS
PAPALPIVVQLMEMGFPRRNIEFALKSLTGASGNASSLPGVEALVGWLLDHSDIQITELS
DADTVSDEYSDEEVVESMEDAAYSLSTGAVVTESQTYKKRADFLSNDDYAVYVRENIQVG
MMVRCCRTYEEVCEGDVGKVIKLDRDGLHDLNVQCDWQQKGGTYWVRYIHVELIGYPPPS
SSSHIKIGDKVRVKASVTTPKYKWGSVTHQSVGIVKAFSANGKDIIVDFPQQSHWTGLLS
EMELVPSIHPGVTCDGCQMFPINGSRFKCRNCDDFDFCETCFKTKKHNTRHTFGRINEPG
QSAVFCGRSGKQMKRCHSSQPGMLLDSWSRMVKSLNVSSSVNQASRLIDGSEPCWQSSGS
QGKHWIRLEIFPDVLVHRLKMIVDPADSSYMPSLVVVSGGNSLNNLIELKTININPTDTT
VPLLSDCAEYHRYIEIAIKQCRSSGIDCKIHGLILLGRIRAEEEDLAAVPFLASDNEEED
DDKGSSGSLIRKKAAGLESAATIRTKVFVWGLNDKDQLGGLKGSKIKVPSFSETLSALNV
VQVAGGSKSLFAVTVEGKVYACGEATNGRLGLGLSSGTVPIPRQITALSSYVVKKVAVHS
GGRHATALTVDGKVFSWGEGDDGKLGHFSRMNCDKPRLIEALKTKRIRDIACGSSHSAAL
TSSGELYTWGLGEYGRLGHGDNTTQLKPKMVKVLLGHRVIQVACGSRDAQTLALTDEGLV
FSWGDGDFGKLGRGGSEGCNIPQNIERLNGQGVCQIECGAQFSLALTKSGVVWTWYVSFL
LSPVHLLVFGICSDSIKKHGLPAVGALAVLVTIKVPSSSDDNGRTHTGEASHGSKQQHLE
NPTMSSVTVGGKHLSLFWCGGLSRLSLSLYILYEIADCRLNYLLLGVPSDADSSATSNKT
SGANSSKPNRPSLAKILLSLDGSLAKQQALSHILTALQIMYARDAVVGALMPAGMIAPVE
CPSFSSSAPPSDASAVTSPMNAEDCILAIDLEDRLSPSPWQEKREIVSSEDAVTPSAVTP
SAPSASSRPFIPVTDDPGAASIIAETMTKTKEDVESQNKASGPEPQSLDEFTSLLIVDDT
RVVVDLLKLSVCSRAGDRGREVLSAVLSGMGTAYPQVADMLLELCVTELEDVATDSQSGR
LSSQPVVVESSHPYTDDTSTSGTVKIPGAEGLRVEFDRQCSTERRHDPLTVMDGVNRIVS
VRSGREWSDWSSELRIPGDELKWKFISDGSVNGWGWRFTVYPIMPAAGPKDLLSDRCVLS
CPSMDLVTCLLDFRLNLTSNRSIVPRLAASLAACAQLSALAASHRMWALQRLRKLLTTEF
GQSININRLLGENDGETRTLSFTGSALAALVKGLPEALQRQFEYEDPVVRGGKQLLHSPF
FKVLVALACDLELDTLPCCAETHKWAWFRRYCMASRVAVALDKRTPLPRLFLDEVAKKIR
ELMADSENMDVLHENHDIFKREQDEQLVQWMNRRPDDWTLSAGGSGTIYGWGHNHRGQLG
GIEGAKVKVPTPCEALATLRPIQLIGGEQTLFAVTADGKLYATGYGAGGRLGIGGTESVS
TPTLLESIQHVFIKKVAVNSGGKHCLALSSEGEVYSWGEAEDGKLGHGNRSPCDRPRVIE
SLRGIEVVDVAAGGAHSACVTAAGDLYTWGKGRYGRLGHSDSEDQLKPKLVEVLQGHRVV
DIACGSGDAQTLCLTDDDTVWSWGDGDYGKLGRGGSDGCKVPMKIDSLTGLGVVKVECGS
QFSVALTKSGAVYTWGKGDYHRLGHGSDDHVRRPRQVQGLQGKKVIAIATGSLHCVCCTE
DGEVYTWGDNDEGQLGDGTTNAIQRPRLVAALQGKKVNRVACGSAHTLAWSTSKPASAGK
LPAQVPMEYNHLQEIPIIALRNRLLLLHHISELFCPCIPMFDLEGSLDETGLGPSVGFDT
LRGILISQGKEAAFRKVVQATMVRDRQHGPVVELNRIQVKRSRSKGGLAGPDGTKSVFGQ
MCAKMSSFSPDSLLLPHRVWKVKFVGESVDDCGGGYSESIAEICEELQNGLTPLLIVTPN
GRDESGANRDCYLFNPAARAPVHGGMFRFLGAGVLLGIAIRTGSPLSLNLAEPVWKQLAG
MSLTIADLSEVDKDFIPGLMYIRDNEATSEEFEAMSLPFTVPSASGQDIQLSSKYTHITL
DNRAEYVRLAINYRLHEFDEQVAAVREGMARVVPVPLLSLFTGYELETMVCGSPDIPLHL
LKSVATYKGIEPSASLVQWFWEVMESFSNTERSLFLRFVWGRTRLPRTIADFRGRDFVIQ
VLDKYNPPDHFLPESYTCFFLLKLPRYSCKQVLEEKLKYAIHFCKSIDTDDYARIALTGE
PAADDSSDDSDNEDVDSFASDSTQDYLTGH
Download sequence
Identical sequences 10141.ENSCPOP00000009549 ENSCPOP00000009549 ENSCPOP00000009549

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]