SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000009716 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSCPOP00000009716
Domain Number - Region: 116-134,165-196
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 0.0542
Family N-acetyl transferase, NAT 0.06
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000009716   Gene: ENSCPOG00000010821   Transcript: ENSCPOT00000010919
Sequence length 243
Comment pep:novel scaffold:cavPor3:scaffold_26:3514525:3515430:1 gene:ENSCPOG00000010821 transcript:ENSCPOT00000010919 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KTVNARDANKETKDQLIIDAGQKYFGVTMCKSCGMIYSASNPEDEIQHIQYHHRFLEGIN
YTSWKRERVVAEFCDGKILLVLPCDPRKVTDVQELVDYELGFQQVVPRCPEKAKTLLFVS
DEKRVVGCLTAEPIKKAFRVLSEPTGPESSGSKECSRAWQCSNVPEPAVCGISRIWVFKL
KRRKCIARRLVDTLRNCFMFGCFLSTNEIAFSDPTPDGKLFATKYRNTPNFLVYNFISTL
TST
Download sequence
Identical sequences ENSCPOP00000009716 10141.ENSCPOP00000009716 ENSCPOP00000009716

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]