SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000009815 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000009815
Domain Number 1 Region: 3800-3994
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.24e-38
Family Laminin G-like module 0.0031
Further Details:      
 
Domain Number 2 Region: 1127-1256
Classification Level Classification E-value
Superfamily Cadherin-like 1.57e-31
Family Cadherin 0.0016
Further Details:      
 
Domain Number 3 Region: 3119-3222
Classification Level Classification E-value
Superfamily Cadherin-like 1.36e-30
Family Cadherin 0.00034
Further Details:      
 
Domain Number 4 Region: 3329-3440
Classification Level Classification E-value
Superfamily Cadherin-like 1.71e-30
Family Cadherin 0.00061
Further Details:      
 
Domain Number 5 Region: 3223-3327
Classification Level Classification E-value
Superfamily Cadherin-like 2.57e-30
Family Cadherin 0.0022
Further Details:      
 
Domain Number 6 Region: 2276-2382
Classification Level Classification E-value
Superfamily Cadherin-like 2.62e-28
Family Cadherin 0.00091
Further Details:      
 
Domain Number 7 Region: 1556-1657
Classification Level Classification E-value
Superfamily Cadherin-like 4e-28
Family Cadherin 0.00088
Further Details:      
 
Domain Number 8 Region: 3017-3125
Classification Level Classification E-value
Superfamily Cadherin-like 1.57e-27
Family Cadherin 0.00066
Further Details:      
 
Domain Number 9 Region: 2803-2911
Classification Level Classification E-value
Superfamily Cadherin-like 3.43e-27
Family Cadherin 0.0014
Further Details:      
 
Domain Number 10 Region: 921-1024
Classification Level Classification E-value
Superfamily Cadherin-like 5.71e-27
Family Cadherin 0.0015
Further Details:      
 
Domain Number 11 Region: 1028-1138
Classification Level Classification E-value
Superfamily Cadherin-like 2e-25
Family Cadherin 0.00061
Further Details:      
 
Domain Number 12 Region: 816-927
Classification Level Classification E-value
Superfamily Cadherin-like 2.57e-25
Family Cadherin 0.001
Further Details:      
 
Domain Number 13 Region: 1759-1879
Classification Level Classification E-value
Superfamily Cadherin-like 2.57e-25
Family Cadherin 0.0019
Further Details:      
 
Domain Number 14 Region: 2584-2721
Classification Level Classification E-value
Superfamily Cadherin-like 6.57e-25
Family Cadherin 0.0011
Further Details:      
 
Domain Number 15 Region: 137-259
Classification Level Classification E-value
Superfamily Cadherin-like 1.16e-24
Family Cadherin 0.0013
Further Details:      
 
Domain Number 16 Region: 2069-2176
Classification Level Classification E-value
Superfamily Cadherin-like 5.28e-24
Family Cadherin 0.0024
Further Details:      
 
Domain Number 17 Region: 2912-3023
Classification Level Classification E-value
Superfamily Cadherin-like 4.14e-22
Family Cadherin 0.003
Further Details:      
 
Domain Number 18 Region: 457-554
Classification Level Classification E-value
Superfamily Cadherin-like 6.71e-22
Family Cadherin 0.00057
Further Details:      
 
Domain Number 19 Region: 3433-3537
Classification Level Classification E-value
Superfamily Cadherin-like 8.14e-22
Family Cadherin 0.0014
Further Details:      
 
Domain Number 20 Region: 2176-2283
Classification Level Classification E-value
Superfamily Cadherin-like 1.83e-21
Family Cadherin 0.0015
Further Details:      
 
Domain Number 21 Region: 709-814
Classification Level Classification E-value
Superfamily Cadherin-like 2.28e-21
Family Cadherin 0.0013
Further Details:      
 
Domain Number 22 Region: 1450-1554
Classification Level Classification E-value
Superfamily Cadherin-like 4.57e-21
Family Cadherin 0.0011
Further Details:      
 
Domain Number 23 Region: 2383-2483
Classification Level Classification E-value
Superfamily Cadherin-like 7.28e-20
Family Cadherin 0.0017
Further Details:      
 
Domain Number 24 Region: 2486-2596
Classification Level Classification E-value
Superfamily Cadherin-like 2.43e-19
Family Cadherin 0.002
Further Details:      
 
Domain Number 25 Region: 1662-1765
Classification Level Classification E-value
Superfamily Cadherin-like 1.16e-18
Family Cadherin 0.0025
Further Details:      
 
Domain Number 26 Region: 1358-1456
Classification Level Classification E-value
Superfamily Cadherin-like 9.55e-18
Family Cadherin 0.007
Further Details:      
 
Domain Number 27 Region: 1233-1353
Classification Level Classification E-value
Superfamily Cadherin-like 2.28e-17
Family Cadherin 0.0037
Further Details:      
 
Domain Number 28 Region: 1872-1970
Classification Level Classification E-value
Superfamily Cadherin-like 3.14e-16
Family Cadherin 0.003
Further Details:      
 
Domain Number 29 Region: 1978-2081
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000000000004
Family Cadherin 0.002
Further Details:      
 
Domain Number 30 Region: 562-662
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000000000183
Family Cadherin 0.0035
Further Details:      
 
Domain Number 31 Region: 2699-2801
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000000014
Family Cadherin 0.0029
Further Details:      
 
Domain Number 32 Region: 367-453
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000000353
Family Cadherin 0.0054
Further Details:      
 
Domain Number 33 Region: 4112-4151
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000839
Family EGF-type module 0.0054
Further Details:      
 
Domain Number 34 Region: 3541-3631
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000243
Family Cadherin 0.0087
Further Details:      
 
Domain Number 35 Region: 34-149
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000123
Family Cadherin 0.0054
Further Details:      
 
Domain Number 36 Region: 4077-4116
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000231
Family EGF-type module 0.016
Further Details:      
 
Domain Number 37 Region: 4038-4074
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000186
Family EGF-type module 0.0091
Further Details:      
 
Domain Number 38 Region: 4000-4037
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000014
Family EGF-type module 0.01
Further Details:      
 
Domain Number 39 Region: 245-354
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000814
Family Cadherin 0.0098
Further Details:      
 
Weak hits

Sequence:  ENSCPOP00000009815
Domain Number - Region: 3779-3810
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0617
Family Laminin-type module 0.073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000009815   Gene: ENSCPOG00000010924   Transcript: ENSCPOT00000011025
Sequence length 4569
Comment pep:known_by_projection scaffold:cavPor3:scaffold_36:7848420:7951240:1 gene:ENSCPOG00000010924 transcript:ENSCPOT00000011025 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGRHLALLLLLLLLLQHLETSDGSQRLEQTPSIQFTHFQYNVTVHENSAKTYVGHPVKMG
IYITDPLWELRYKIVSGDNENLFKAEEYILGDFCFLRIRTKGGNTAILNREVKDHYTLIV
KAVEKNTNAEARTKVRVQVLDTNDLRPLFSPTSYSVSLPENTAIRTSIAKVSATDADIGT
NGEFYYSFKDRTDMFAIHPTSGAVVLTGRLDYMETQLYELEILAVDRGMKLYGSSGISSL
AKLTVHVEQANECAPVITAVTLSPSELDRDPTYAIVTVDDCDQGANGEIASLSIVAGDLL
QQFRTVRSFPGSKEYKLKAISSIDWDSHPFGYNLTLQAKDKGTPPQFSSVKVIHVTSPQF
RVGPVKFEKDVYRAEISEFAPPNTPVVMIKAIPSYSHLRYVFKSTPGKAKFSINPNTGLI
SILEPIKRQQVSHFEFEVTTGDRKASTKVLVKVLSANSNPPEFTQTAYRASFDENALIGT
TVLRVSAVDPDDGENGYVTYSIANVNPVPFVINHFTGAVSTSENLDYELMPRVYTLRIRA
SDWGLPYRREVEVLATVTLNNLNDNTPLFEKINCEGTVPRDLSVGEQITTVSAIDADELQ
LVRYQIEAGNELDLFDLNPSSGVLSLKQSLVDGLGAKVSFHSLRITATDGENFAVPLYIN
ITVAASRKPVNLQCEETGVAKMLAEKLLQANKLHSQGEVEDIFFDSHSVNAHAPQFRNTL
PGGIEVKENQPVGSNVIFMNATDLDSGFNGKLVYAISGGNEDSCFIIDMETGMLKILSPL
DRETTDKYTLNMTVYDLGIPQKAAWRLLDIVILDANDNPPEFLQESYFVEVSEDKEINSE
IIQVEATDKDLGSNGHVTYSILTDTDKFSIDSITGVVKVVHPLDREVQHVHYLKIEARDQ
AKEELQLFSTVLLKVSLEDVNDNPPKFIPPNYRVKVREDLPEGTIIMWLEAYDPDVGQSS
QVRYSLLDHGEGNFDVDKLSGAVRIVQQLDFERKQVYNLTVRAKDKGKPVSLSSTCYVEV
EVVDVNENLHTPVFSSFVEKGIVKEDVPIGSSVMTVSARDEDTGRDGEIRYSIRDGSGVG
VFKIDEETGVIETSDRLDRESTSHYWLTVYATDQGVVPLSSFIEIYIEVEDVNDNAPQTS
EPVYYPEIMENSPKDVSVVQIEAFDPDSSSNDKLMYKITSGNPQGFFSIHPKTGLITTTS
RRLDREQQDEHILEVTVTDNGTPPKSTIARVIVKILDENDNKPQFLQKFYKIRLPEREKP
ERERNAKREPLYRVIATDKDEGPNAEISYSIEEGNEHGRFFIEPKTGVVSSKKFSAAGEY
DILSIKAVDNGRPQKSSTTRLHIEWISKPKPPPEPISFEESVFTFTVMESDPVAHMIGVI
SVEPPGTPLWFDITGGNFDSHFDVDKGTGTIIVAKPLDAEQKSNYNLTVEATDGTTTILT
QVLIKVIDTNDHRPQFSTSKYEVVIPEDTAPETEILQIRAVDKDEKNKLIYTLQSSIDPL
SLKKFRLDPATGSLSTCEKLDHEAVHQHILTVMVRDQDVPVKRNFARIIVNVSDTNDHAP
WFTSSSYEGRVYESAAVGSVVLQVTALDKDKGKNAEVVYSIESGNIGNSFTIDPILGSIK
TAKELDRSHQEEYDLMVKAADKGNPPMSEMTSVHIFVTIADNASPKFTSREYSIEISETI
SIGSFVGIVTAYSQSSVVYEIKDGNIGDAFDINPHSGTVITQKALDFETLPIYTLIIQGT
NMAGLSTNTTMLVHLQDENDNVPVFMQAEYSGLISESASINSVVLTDRNVPLVIRATDAD
KESNALLVYHIVEPSVHKYFAIDSSTGAIHTVLSLDYEETSVFHFTVQVHDMGTPRLFAE
YAANVTIHVIDINDCPPVFSKSLYEASLLLPTYKGVKVITVNATDADSSAFSQLMYSITE
GNIGEKFFMDYKTGTITIQNTTQLRSRYELTIRASDGRFASFTSVKINVKESKESQLKFT
QDFYSAVVKENSTEATTLAVITAVGNPINEPLFYHILNPDRRFKISRTSGVLSTTGVPFD
REQQEAFDVVVEVTGEHKPSAVAHVVVKVTVEDQNDNAPVFINLPYYAVVKVDTEVGHVI
RYVTAVDRDSGRNGEVHYYLKEHHDHFQIGPAGEISLKKQFELDTLNKEYLVTVVAKDGG
NPAFSAEVIVPITVMNKAMPVFEKPFYSAEIPENIQVHSPVVHIQANSPEGLKVFYSITD
GDPFSQFTINFNTGVINVIAPLDFESHPAYKLSIRATDSLTGAHAEVFVDIIVEDINDNP
PVFVQQSYSATLSEASVIGTSVVQVRATDSDSEPNRGISYQMFGNHSKSHDHFHIDSTTG
LISLLRTLDYEQFQQHKIFVRAIDGGMPPLSSDVIVTVDVTDLNDNPPLFDQQIYEAKIS
EHAIHGHFVTCVKAYDADSSDIDRLEYSILSGNDHKNFVIDSETGIITLSNLRRHTLKPF
YSLNISVSDGVFRSSAQVHVVVIGGNLHSPVFPQNEYEVELAENAPVHTLVIEVKATDRD
SGIYGHITYNIVNDFAKDRFYPNERGQIFTLEKLDRETPAEKVISIRLMAKDAGGKVAFC
TINVILTDDNDNAPQFRATKYEVNIGSNAAKGTSVIKVFASDADEGSNADVIYAIEADSE
SVKENLEINKLTGVITTKESLIGLENEFFTFFVRAVDNGSPPKESVVPVYVKILPPERHL
PKFSEPFYTYTVSEDMPIGTEIDLIRAEHSGTVLYSLTKGNTPESNRDEFFVIDRQSGRL
KLEKSLDHETTKWYQFSILARCTQDDYEVVASVDVSIQVKDANDNSPVLESNPYEAFIVE
NLPGGSRVIQIRASDLDSGLNGHVMYSLDQSQSVDIIESFAINAETGWITTLKELDHEER
DNYQIKVVASDHGEKVQLSSTAVVDVTVTDVNDSPPRFTAEIYKGTVSEDDPPGGVIAIL
STTDADSEEINRQVTYFITGGDALGQFAVENIQNEWKVYVKKPLDREKKDSYLLTITATD
GTFSSKAIVEVKVLDANDNSPVCEKTLYSDTIPEDALPGKLIMQVSATDADIRSNAEITY
TLLGSGAEKFRLNPDTGELKTLAPLDREEQAVYNLLVKATDGGGRFCQASIVLTLEDVND
NAPEFTADPYTITVFENTEPGTLLTRVQATDADTGLNRKISYSLIDSANGQFSINDISGI
IQLEKPLDREQQAVYTLTLKAVDQGLPRRLSATGTVIVSVLDINDNPPVFEYREYGATVS
EDVLIGTEVLQLYAASRDIEANAEITYSIISGNEHGKFSIDAKTGAIFIIENLDYESAHE
YYLTVEATDGGTPSLSDVVTVNINVTDINDNTPAFSQDTYTAVISEDAVLEQSVITVMAD
DADGPLYSLIHYSIIEGNQGGPFTIDPVKGEVKVTKLLDRETISGYTLTIQASDNGSPPR
VNTTTVNIDVSDVNDNAPLFSKGNYSVIIQENKPVGFSVLQLVVTDKDSSHNGPPFFFSI
VSGNDDRVFEVNQQGVLLTSAAIQRKVKDHYLLHVKVADNGKPQLSSLTHIDIRVIEESI
HPPAILPLEIFITAFGEEYSGGVIGKIHATDQDVYDTLTYSLDPQMDNLFSVSSTGGKLI
AHKRLDIGQYLLNVSVTDGKFTTVADITVHIRQITQEMLNHTIAIRFANLTPEEFVGDYW
RNFQRALRNILGVRRNDIQIVSLQPSEPHPHLDVLLFVEKSSSTQVSTKQLLHKINSSVT
DIEDIIGVRILDVFQKRCAGLDCPWKFWYLVDENXPRHYRAAVCLCKKEGKCPPVHHGCE
DSPCPEGTECVPDPREEKYTCVCPGGRFGQCPGSSSLTFTGNSFVKYRLMENENKLEMKL
TMRLRTYSTHAIVMYARGTDYSILEIHNGRLQYKFDCGSGPGIVSVQSIQVNDGQWHAVS
LEVNGNYARLVLDQVHTASGTAPGTLKTLNLDNYVFFGGHIRQQGARHGRSPQVGNGFRG
CMDSIYLNGQELPLNSKPRSYAHIEDSVDVSPGCLLTATEDCSSNPCQNGGICHPSPTGG
YYCKCSALYIGTYCEVSVNPCSSNPCLYGGTCVVDNGDFVCQCRGLYTGQRCQLSPYCKD
EPCKNGGTCFDSLDGAVCQCDSGFRGERCQSDIDECAGNPCRNGALCENTHGSYHCNCSH
EYRGKHCEEATPNLYVSTPWNIGLAEGIGIIVFIAGIFLLVVVFVLCRKMISRKKKHQAE
PEDKHLGPTTAFLQRPYFDSKLNKNIYSDIPPQVPVRPISYTPSIPSDSRNNLDRNSFEG
SAIPEHPEFSTFNPESMHGHRKAVAVCSVAPNLPPPPPSNSPSDSDSIQKPSWDFDYDAK
VVDLDPCLSKKPLEEKPSQPYSARESLSEVQSLSSFQSESCDDNGYHWDTSDWMPSVPLP
DIQEFPNYEVIDEHTPLYSADPNAIDTDYYPGGYDIESDFPPPPEDFPATDELPPLPPEF
SDQFESIHPPRDMPAAGSLGSSPRNRQRFNLNQYLPNFYPVDMSEPTGENSTCREPYAPY
PPGYQRNFDAPTVENMPMSVYASTASCSDVSACCEVESEVMMSDYESGDDAHFEEVTIPP
LDSQQHTEV
Download sequence
Identical sequences ENSCPOP00000009815 ENSCPOP00000009815 10141.ENSCPOP00000009815

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]