SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000009997 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000009997
Domain Number 1 Region: 783-892
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.4e-25
Family Spermadhesin, CUB domain 0.0021
Further Details:      
 
Domain Number 2 Region: 250-369
Classification Level Classification E-value
Superfamily Growth factor receptor domain 2.82e-17
Family Growth factor receptor domain 0.016
Further Details:      
 
Domain Number 3 Region: 4-133
Classification Level Classification E-value
Superfamily Growth factor receptor domain 4.08e-17
Family Growth factor receptor domain 0.019
Further Details:      
 
Domain Number 4 Region: 155-305
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000675
Family Growth factor receptor domain 0.014
Further Details:      
 
Domain Number 5 Region: 661-779
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000114
Family Growth factor receptor domain 0.01
Further Details:      
 
Weak hits

Sequence:  ENSCPOP00000009997
Domain Number - Region: 482-503
Classification Level Classification E-value
Superfamily alpha-Amylase inhibitor tendamistat 0.0785
Family alpha-Amylase inhibitor tendamistat 0.0089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000009997   Gene: ENSCPOG00000011118   Transcript: ENSCPOT00000011222
Sequence length 970
Comment pep:known_by_projection scaffold:cavPor3:scaffold_134:162177:217665:1 gene:ENSCPOG00000011118 transcript:ENSCPOT00000011222 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DIDECAQGLDDCHADALCQNTPTSYKCSCKPGYQGEGRQCQDIDECENELNGGCVHDCLN
IPGNYRCTCFDGFMLAHDGHNCLDVDECLENNGGCQHTCVNAMGSYECRCKEGFFLSDNQ
HTCIHRSEEGLSCMNKDHGCSHICKEAPRGSVACECRPGFELAKNQRDCILTCNHGNGGC
QHSCEDTAEGPECSCHPQYKLHTDGRSCFETCAVNNGGCDRTCKDTSTGVHCSCPVGFTL
QLDGKTCKDIDECQTRNGGCDHFCKNTVGSFDCSCKKGFKLLTDEKSCQDVDECSLDRTC
DHSCLNYPGTFACACDPGFTLYGFTHCGDTNECSDNNGGCQQVCVNTVGDYECQCHPGYK
LHWNKKDCVEVKGFLPTSVLPHVSLLCSKSGGGDRCFLRCHSGIRISSGPQEAYSVTCGS
SSSLREGAENLQGHCLQRMESLTEHPCVVLGLHLGASFKILMFASKISQRNAHLSKGGKA
GAPIPPPACVAVKESFRYVNLTCSSGKQVLGAPGRPSTPKEMFLTVEFERETYQKEVTAS
CDLSCIAKRTEKRLRKALRTLRKAVHREQFHLQLSGMDLDVAKKSPRASEWRAESCGVGQ
GHVGNQCVSCRAGTYYDGAQERCILCPNGTFQNEEGQVTCEPCPRPENIGALKTSEAWNV
SECGGLCQPGEYSVDGFAPCQLCALGTFQPEAGRTSCFSCGGGLPTKHLGATSFQDCETR
AVQCSPGHFYNTTTHRCIRCSSGTYQPEFGKNSCVSCPGNTTTDFDGSTNITQCKNRRCG
GELGDFTGYIESPNYPGNYPANTECTWTINPPPKRRILIVVPEIFLPIEDDCGDYLVMRK
TSSSNSVTTYETCQTYERPIAFTSRSKKLWIQFKSNEGNSARGFQVPYVTYDAEDYQELI
EDIVRDGRLYASENHQEILKDKKLIKALFDVLAHPQNYFKYTAQESREMFPRSFIRLLRS
KVSRFLRPYK
Download sequence
Identical sequences ENSCPOP00000009997 ENSCPOP00000009997 10141.ENSCPOP00000009997

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]