SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000010007 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000010007
Domain Number 1 Region: 94-188
Classification Level Classification E-value
Superfamily Snake toxin-like 4.58e-38
Family Extracellular domain of cell surface receptors 0.0000333
Further Details:      
 
Domain Number 2 Region: 193-274
Classification Level Classification E-value
Superfamily Snake toxin-like 2.25e-19
Family Extracellular domain of cell surface receptors 0.00012
Further Details:      
 
Domain Number 3 Region: 6-82
Classification Level Classification E-value
Superfamily Snake toxin-like 0.000000000000146
Family Extracellular domain of cell surface receptors 0.00014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000010007   Gene: ENSCPOG00000011128   Transcript: ENSCPOT00000011232
Sequence length 314
Comment pep:known_by_projection scaffold:cavPor3:scaffold_80:4779664:4791685:-1 gene:ENSCPOG00000011128 transcript:ENSCPOT00000011232 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PASWALICLHCRSNGPCQVETCAAGQDLCRTTVIRVWKVDEELEMVEKCAHTEKSNRTMS
YRMGSEIISLTETVCGSNLCNKPTRSQPRTVVLGRYLECVSCTSLDMSCERGREQTLQCR
YPREQCIEVVTHHSQEANWRDERHTRGCGFLPGCPGPTSFHNNLTFHYLRCCNSTKCNGG
PVIELKNLPPNGVQCYSCEGNSTHGCSSSENSLIDCRGPMNQCLEATGTKGMENKTVTVR
GCTTASWCQDSHMADTFSLTRVSVSCCEGSGCNDPASDIHYRSGGAPQPGPVPLSLASTL
LVILRLWGGVFLWT
Download sequence
Identical sequences 10141.ENSCPOP00000010007 ENSCPOP00000010007 ENSCPOP00000010007

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]