SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000010147 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000010147
Domain Number 1 Region: 583-934
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 1.3e-110
Family PDEase 0.00000229
Further Details:      
 
Domain Number 2 Region: 399-578
Classification Level Classification E-value
Superfamily GAF domain-like 3.49e-48
Family GAF domain 0.0000000626
Further Details:      
 
Domain Number 3 Region: 226-409
Classification Level Classification E-value
Superfamily GAF domain-like 5.89e-34
Family GAF domain 0.0000000198
Further Details:      
 
Domain Number 4 Region: 46-200
Classification Level Classification E-value
Superfamily GAF domain-like 0.0000286
Family GAF domain 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000010147   Gene: ENSCPOG00000011286   Transcript: ENSCPOT00000011392
Sequence length 943
Comment pep:known_by_projection scaffold:cavPor3:scaffold_103:2736071:2824025:1 gene:ENSCPOG00000011286 transcript:ENSCPOT00000011392 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGQACGHSILCRSQQYPAARPAEPRGQQVFLKPDEPPPPPPQPCADNLQDALLTLGSVID
FVGLRRAAKEALSAVLPRVEMVYTYLMDGESRLMCEDPHHELPQEGKVREAVISGKRLSC
NGLGPSDLLGKPLARMAAPLAPDTQVLVIPLADKEAGTVAAVILVHCGQLSDSEECSLQA
VEKHTLVALRRVQALQQREPSANPEAEQKPPAEAAEDQKAEIQYTDQDRKILQLCGELYD
LDATLLQLKVLQYLQQETQASRCCLLLVSEDNLQLSCKVIGDKVLGEEISFPLTVGRLGQ
VVEDKKPIQLQDLTSEDVKQLQNMLGCELQTMLCVPVISRATDQVVALACSFNKLGGDLF
TGQDERVIQHCFHYTSTVLTSTLAFQKEQKLKCECQALLQVAKNLFTHLDDVSVLLQEII
TEARNLSNAEICSVFLLDQNELVAKVFDGGVVDDESYEIRIPADQGIAGHVATTGQILNI
PDAYAHPLFYRGVDDSTGFRTRNILCFPIKNENQEVIGVAELVNKINGPWFSKFDEDLAT
AFSIYCGISIAHSLLYKKVNEAQYRSHLANEMMMYHMKVSDDEYTKLLHDGIQPVAAIDS
NFASFTYTPRSLPEDDTSMAILSMLQDMNFINNYKIDCPTLARFCLMVKKGYRDPPYHNW
MHAFSVSHFCYLLYKNLELTNYLEDIEIFALFISCMCHDLDHRGTNNSFQVASKSVLAAL
YSSEGSVMERHHFAQAIAILNTHGCNIFDHFSRKDYQRMLDLMRDIILATDLAHHLRIFK
DLQKMAEVGYDPTNKQHHRLLLCLLMTSCDLSDQTKGWKTTRKIAELIYKEFFSQGDLEK
AMGNRPMEMMDREKAYIPELQISFMEHIAMPIYKLLQDLFPKAAELYERVASNREHWTKV
SHKFTIRGLPSNNSLDFLDEEYEVPELGSTKGPINGCCSLDAE
Download sequence
Identical sequences 10141.ENSCPOP00000010147 ENSCPOP00000010147 XP_003463456.1.53824 ENSCPOP00000010147

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]