SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000010167 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000010167
Domain Number 1 Region: 4-155
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 3.65e-39
Family N-acetyl transferase, NAT 0.000000203
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000010167   Gene: ENSCPOG00000011307   Transcript: ENSCPOT00000011413
Sequence length 170
Comment pep:known_by_projection scaffold:cavPor3:scaffold_61:9033159:9034275:1 gene:ENSCPOG00000011307 transcript:ENSCPOT00000011413 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAVRIREAEEGDCGDVLRLIRELAEYEKLSEQVTISEEGLRADGFGENPFYHCLVAEIL
PAPGDPQGPRIVGYGLYCFVYSTWKGRNIYLEDIYVMPEYRGQGIGSKIIKKVAEVALDQ
GCSQFRLAVLEWNKRAIDLYKALGARDLTQEEGWHAFRFEGEAMEKLAGR
Download sequence
Identical sequences A0A286X9C1
ENSCPOP00000010167 ENSCPOP00000010167 XP_003466297.1.53824 10141.ENSCPOP00000010167

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]