SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000010249 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000010249
Domain Number 1 Region: 91-273
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 2.45e-50
Family Astacin 0.00019
Further Details:      
 
Domain Number 2 Region: 444-616
Classification Level Classification E-value
Superfamily TRAF domain-like 8.34e-36
Family MATH domain 0.0011
Further Details:      
 
Domain Number 3 Region: 282-445
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.32e-28
Family MAM domain 0.0053
Further Details:      
 
Domain Number 4 Region: 686-729
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000666
Family EGF-type module 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000010249   Gene: ENSCPOG00000011402   Transcript: ENSCPOT00000011508
Sequence length 760
Comment pep:known_by_projection scaffold:cavPor3:scaffold_15:28907491:28928359:-1 gene:ENSCPOG00000011402 transcript:ENSCPOT00000011508 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QGAYAKLSSLARMVCIRSSCILSLTLLFAHTAAVSVKHLSSGNVQDVDFGEPKDIPEINL
DVAAGLDLFQGDILLPKSRNALRNPTARWTFPIPYILADNLELNAKGAILKAFEMFRLKS
CVDFKPYEGESSYIIFQQFSGCWSMVGNQHVGQNLSIGLGCDYKAIVEHEILHALGFYHE
QSRTDRDDYVTIWWDEIISGYEHNFNTYDDNRITDLNTPYDYESVMHYAPFSFNQNENVP
TITTKIPEFNTIIGQRLDLSATDLERLNRMYNCTTTHTLLDHCDFEKTNICGMIQGTSDD
ADWVHKGSTNATQGDHTLGGRCTGAGYSMHFDTDEGALEEAALLESRILYPKRKQQCLQF
FYRMTGSPSDRLVIWVRRDDGTGNVRKLAKVQTFQGDSNHNWKIAHVTLREEKKFRYLFQ
GTKGNPQLSAGGISLDDITLTETPCPTGVWTVRNFSQVLQNTVKGDKLLSPRFYNSEGYG
FGVILYPHDRATSSASGYLGLTFHLCSGENDAILEWPVQNRQAIITILDQEPDVKNRMSL
SRMLTTSLAHTSEEINGSVIWDRPSVVGSYDKDCDCFRSRERGWTRVLSHQMLQRRSFLK
NDDLIIFVDFEDLTHLNRTEVPVKAVDARLVPAGLVLQGQEQQVLGEGSRKAVLDEAPSD
SLGRQKRSMENTGPLEDHNWPQYFRDPCDPNPCQNEGVCVNVKGMASCRCVSGHAFFYTG
ERCQAMQVHSSTLSLVIGGTATVIFLTFAIISIILQRPRP
Download sequence
Identical sequences ENSCPOP00000010249 10141.ENSCPOP00000010249 ENSCPOP00000010249

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]