SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000010355 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000010355
Domain Number 1 Region: 343-603
Classification Level Classification E-value
Superfamily YWTD domain 4.45e-56
Family YWTD domain 0.0000000251
Further Details:      
 
Domain Number 2 Region: 136-173
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000249
Family LDL receptor-like module 0.00078
Further Details:      
 
Domain Number 3 Region: 45-81
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000288
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 4 Region: 172-212
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000654
Family LDL receptor-like module 0.00091
Further Details:      
 
Domain Number 5 Region: 85-121
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000615
Family LDL receptor-like module 0.00091
Further Details:      
 
Domain Number 6 Region: 5-44
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000275
Family LDL receptor-like module 0.00071
Further Details:      
 
Domain Number 7 Region: 287-334
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000353
Family EGF-type module 0.0014
Further Details:      
 
Domain Number 8 Region: 259-302
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000536
Family EGF-type module 0.0043
Further Details:      
 
Domain Number 9 Region: 216-253
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000249
Family LDL receptor-like module 0.00064
Further Details:      
 
Domain Number 10 Region: 614-654
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000804
Family EGF-type module 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000010355   Gene: ENSCPOG00000011514   Transcript: ENSCPOT00000011622
Sequence length 882
Comment pep:known_by_projection scaffold:cavPor3:scaffold_321:4710:34968:1 gene:ENSCPOG00000011514 transcript:ENSCPOT00000011622 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SAARQVCPAEKMSCGPTSHKCVPASWRCDGEKDCEGGADEAGCATLCAPHEFQCGNRSCL
ASVFVCDGDDDCGDGSDERGCADLACGPREFHCGDSSGCIPDRWVCDRQFDCEDGSDEVA
EHCGRAGQGTTSAPAACAPSTQFSCRSGECIYLGWRCDGDHDCKDKSDEADCLLATCRED
EFQCGDGTCVLEIKRCNQARDCPDGSDEAGCLQESTCEGPRRFQCKSGECVDGGKVCDAQ
KDCQDWSDELLKECGLNECLHNNGGCSHICTDLKMGFECSCPAGLRLLDNKTCGDIDECE
DPDVCSQICVNYKGYFKCECHPGYEMDTLTKNCKAVAGKNPSLIFTNRHEVQRIDLVKRD
YSRLIPMLKNVVALDVEVATNRIYWCDLSYRKIYSANMDKASNPADQEVLISEQLHSPEG
LAVDWVHKHIYWTDSGNKTISVATLDGRRRCTLFSRDLSEPRAIAVDPLRGFMYWSDWGY
QAKIEKAGLNGMDRQTLVSYNIEWPNGIALDLLNQRLYWVDSKRHELASVDFSGHNRRIL
ISSSDFLSHPFGIAVFEDKVFWTDLENEAIFSANRLTGLEISILAENLNNPHDIVIFHEL
KQPRAEDACQLSAQPNGGCEYLCLPAPQIPSSSVKYTCACPDTMWLGPDMKRCYRAPQST
STTTLASTTTRTVAATARAPGTTIYSSTYQNHTTETPSLTAAAPSSVSVPRAPSVSPSTP
SPATSNHSQHYGNEGGKMGSTVTAAVIGIIVPIAVIALLCLSGYLIWRNWKRKNTKSMNF
DNPVYRKTTEEEDDDELHIGRTAQIGHVYPAAIRSFDRPMWAEPCLGETRELEDPAPALK
ELFVLPGEPKSQLHQLPKNPLSELPVVKCKRVALSLEDDGLP
Download sequence
Identical sequences ENSCPOP00000010355 ENSCPOP00000010355 10141.ENSCPOP00000010355

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]